Os09t0459900-02

Locus

Os09g0459900

Description

Cyclin-dependent kinase inhibitor family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

KRP6

CGSNL Gene Name

KIP-RELATED PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

OsiICK4, Orysa;KRP6, OrysaICK4, Orysa;ICK4, OsKRP6

Oryzabase Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 4, KIP-related protein 6, inhibitor of cyclin-dependent kinase 4

Transcript Evidence

AK063208 (DDBJ, Best hit)

Protein Evidence

B9G407 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell cycle arrest (GO:0007050)

Cellular Component: nucleus (GO:0005634)

Molecular Function: cyclin-dependent protein kinase inhibitor activity (GO:0004861)

Functional domain (InterPro)

Cyclin-dependent kinase inhibitor (IPR003175)

Full-length cDNA

001-112-D03 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0459900-02)

RiceXPro (AK063208)

Others

Oryzabase (12357)

KEGG (Os09t0459900-02)

Transcript

557 bp

>Os09t0459900-02 Cyclin-dependent kinase inhibitor family protein.
AGCATTAGCATTAGCATAAGGGAGGGAGGGAGGGAGGGATCATTAGAGGAGGAGCACAGC
ACATGGCTGCCGCGGCCGCCACCGTGACGGCGGTGCAGCCAGCGGCGTCGAGCTGCGGCA
AGCGCGACGGCGACAATGCGTGCGTCGTCGACATGCCCAGGAAGGCGAAGAAGGGGAGGT
CGCCGCCGGAGGAGGAGGTGGAGGCCTTCCTCGCCGCGGCGGAGAGCAGCGTGGCGCGGC
GCTTCGCGGCCAAGTACAACTATGACATCGTCAAGGACGCTCCGATGGATGGCCGGTACG
AGTGGGTCCGGGTACGCCCGTAAAGAGGATATGTGGCAACAGCCAGTCAAAATGTCAGGA
GGATGCACAGACCAATCCTGTCCTAATGAATCTTTTCTTTACCCATGTATATGTAGTTAC
TCGGTTACTCCATGTCATGTGTTTAGCTGTAATTTATTTAAGCTCACGAGATGACTAATC
ATGTAAAAGCTCACCTTGTACGTTAGCAGTAGATGCTTCGCCTGTAACGCATATGCTTAA
CTTGTCGTTATCCGTGG

CDS

261 bp

>Os09t0459900-02 Cyclin-dependent kinase inhibitor family protein.
ATGGCTGCCGCGGCCGCCACCGTGACGGCGGTGCAGCCAGCGGCGTCGAGCTGCGGCAAG
CGCGACGGCGACAATGCGTGCGTCGTCGACATGCCCAGGAAGGCGAAGAAGGGGAGGTCG
CCGCCGGAGGAGGAGGTGGAGGCCTTCCTCGCCGCGGCGGAGAGCAGCGTGGCGCGGCGC
TTCGCGGCCAAGTACAACTATGACATCGTCAAGGACGCTCCGATGGATGGCCGGTACGAG
TGGGTCCGGGTACGCCCGTAA

Protein

87 aa

>Os09t0459900-02 Cyclin-dependent kinase inhibitor family protein.
MAAAAATVTAVQPAASSCGKRDGDNACVVDMPRKAKKGRSPPEEEVEAFLAAAESSVARR
FAAKYNYDIVKDAPMDGRYEWVRVRP*

5'UTR

chr09:17392480..17392541 (- strand) : 62 bp

CDS

chr09:17392388..17392479 (- strand) : 92 bp

chr09:17392207..17392305 (- strand) : 99 bp

chr09:17391211..17391280 (- strand) : 70 bp

3'UTR

chr09:17390977..17391210 (- strand) : 234 bp

FASTA

>Os09t0459900-02 class=Sequence position=chr09:17390977..17392541 (- strand)
AGCATTAGCA TTAGCATAAG GGAGGGAGGG AGGGAGGGAT CATTAGAGGA GGAGCACAGC ACATGGCTGC CGCGGCCGCC
ACCGTGACGG CGGTGCAGCC AGCGGCGTCG AGCTGCGGCA AGCGCGACGG CGACAATGCG TGCGTCGTCG ACATGTGCGC
CTCTCTCAAT CTTCCCCGTC GTCCCTTCTT CCTCTTCCTG ACATGTTATC ACGTCACGCG CGTGCGTTCA CTGCAGGCCC
AGGAAGGCGA AGAAGGGGAG GTCGCCGCCG GAGGAGGAGG TGGAGGCCTT CCTCGCCGCG GCGGAGAGCA GCGTGGCGCG
GCGCTTCGCG GCCAAGTGAG TACTAAGTAC ATTACGGCAG CATCGCACGG TGACATCGTC TCAGCGCGAG CGAGCTGTGG
CCTTTCTGTG ACCGTAAGGT TTGGTTTTCT CGGGGATTTA TATAGCTATA GCCCTTGCAC TCGCAGCATC GGCACGGCAG
TGGGCCTGTA AAATTTTCCG CTGCTGCTGA AGCTCGCGAA GTGCAGCTTG TCAGTGTGGT GTTGTTGCAC TCGCAGACAG
TAAAAACGCC AAATGGGGTT ACTGTACATG CCTCTGGGCT TGTGGTTTCC TCTGTATTTT TCTCTTGCTT TTTGTATGCT
TAGGCACCgt ttagatcccg aacttttttt tttcaaactt ttaacttttc tgtcacatcg aattttctta cacacataaa
tttttaaatt tttctttaca tcgttctaat ttctttaaac ttttaatttt gacgtggaac taaacacagc ctTATTCTAT
TATGCCAAAT GGAGTTCTGC TTTTTTGGAA GGAATGCTGC TCAGCTGCTA GTGTAGAACC TAACAAAGTT ACTGCACAGC
TTGGAGTCTT GGCATCCTGA TCAGGTCTCT AAAATACTTG GAGCTCTAGA GATCATGGGA TAGCTCGAAC AACAATACCT
TTTCTCCATC GTAATCCTGG CTTCTCAACT CCAAGTGGAC TTCTCTTTTC TTAAAAAAAT CCAGCTGGTT CAGCCTGTGC
TGATGTTCTC CAACTGGGAC AGGCTGTAGA GTTTTCATGC CACCACTGCC CCAAAATTTT GAAAAATAAA TTGGTTCTTT
TTTCCTGTTT TGCCAGTTCG AGGGTTTGCC AAATGTGAAG TACTATTAGT GGAGGAGTAG TTAGTAGTGT TCAAAATGCT
GCCAGGGCAA CAATAACCCG TGTTGTAGTA ATAACGTTTG TATCTTTTGG CTGTGTTAAA GGTACAACTA TGACATCGTC
AAGGACGCTC CGATGGATGG CCGGTACGAG TGGGTCCGGG TACGCCCGTA AAGAGGATAT GTGGCAACAG CCAGTCAAAA
TGTCAGGAGG ATGCACAGAC CAATCCTGTC CTAATGAATC TTTTCTTTAC CCATGTATAT GTAGTTACTC GGTTACTCCA
TGTCATGTGT TTAGCTGTAA TTTATTTAAG CTCACGAGAT GACTAATCAT GTAAAAGCTC ACCTTGTACG TTAGCAGTAG
ATGCTTCGCC TGTAACGCAT ATGCTTAACT TGTCGTTATC CGTGG

Locus: Os09g0459900

Loading...

Locus: Os09g0459900

Loading...