Os09t0469400-01

Locus

Os09g0469400

Description

Similar to isoamylase-type starch debranching enzyme ISO3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ISA3

CGSNL Gene Name

ISOAMYLASE 3

Oryzabase Gene Symbol Synonym(s)

OsISA3

Oryzabase Gene Name Synonym(s)

isoamylase-3, isoamylase3

Transcript Evidence

AK101554 (DDBJ, Best hit)

Protein Evidence

NP_001105198.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 13, N-terminal (IPR004193)

Glycosyl hydrolase, family 13, catalytic domain (IPR006047)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Immunoglobulin-like fold (IPR013783)

Alpha amylase (IPR015902)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

J033050A06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0469400-01)

Others

Oryzabase (6180)

Transcript

3441 bp

>Os09t0469400-01 Similar to isoamylase-type starch debranching enzyme ISO3.
GCTCCGCTCCACCGCGTGTCCCACTCCCACCACCCCCGCTCTCCCGTCCGTCCGCGCGCT
TCCCCCCATGCGAGATCACCGTCTCCTCCGCCTCCTCCTCGTTGGCTCGTCCTCTTCCCC
CATCCGCCTCTCTCTCTCTCTCTCTTTCTCTCTCTCTCCAGTCTCCTCCACTCTCCTCTC
TTCGAGAGCCGCTCGCGACGCGAGCCTCTTGGAGCGCGCGCCCTATAACTAGGCACCCGT
GTCCCCGTCCCGGATCTCCCCCCCACCCGTCGCTCCGCCCCGTCCCCATTTTGGATGGAT
TCCATTGGTATAAATCGCGCCCCGCTGGGTTCCTCCTCCTCCGCCGCCGCCGTGACAGCT
CGTCGAGGCATCGCGCTCCGCCCGGCTCGCCGCTCCGTCGCGAGTACGAACCGTGTGGGT
GTGGCGACGATCGGCTTCGGGGACGCGTCTGGGCTCAGAGCGTGTTCTGAGAAGGCAGGC
GATTTGATTCTGTACGAAGCACCACGGCGAGAGCTCAGAACGGGAACGCTGGGAGAAGCA
TGACCGAGGAAAGAGGATGTACAATGTCTGATACTGAAATGCCATTTAAATATTCCTCTG
GTAAAGCCTTCCCATTAGGAGTGTCTCAAGTTGAAGGCGGGCTGAACTTCGCACTTTTCT
CTCAGCATGCTTCTTCTGTCATTCTCTGCTTAAAGCTTCCTGGGAGGGGAACTGAAGATG
AGAAAGGTGCAGATGTTGTCGAGTTTGTTTTAGACCAGCAGAAGAACAAAACTGGGGATA
TATGGCATGTGATAGTGGAGGGCTTGCCTGCTTCTGGTGTTCTTTATGGGTATCGTGTTG
GTGGCCCTCAAGGATGGGACCAAGGCCATAGATTTGATAGCAGCACTGTTCTTCTGGACC
CTTATGCAAAATTAGTTTCTGGTCGAAAGTACTTTGGGGTTGCTGAAGAGAAGTCAAGCC
AGCATTTTGGAACATATGATTTTGATAGCTCTCCTTTTGATTGGGGTGATGACTACAGGC
TTCCGAATTTGCCTGAGGCAGATCTAGTCATATATGAAATGAACGTCCGTGCTTTCACCG
CGGATGAGTCAAGTGGCCTTGATTCGACTTCTCGTGGAAGCTATCTTGGTCTCATTGATA
AAATCCCTCATTTGCTGGAACTTGGCGTTAATGCAGTGGAACTACTTCCTGTTTTTGAGT
ATGATGAGCTGGAATTCAAGAGGTACCCCAACCCAAGGGACCACATGGTCAATACATGGG
GCTATTCTACGATAAACTTTTTTGCACCCATGAGCCGTTATGCTAGTGCCGGTGGTGGAC
CAGTGGCTGCTTCCAAAGAGCTCAAGCAGATGGTCAAAGAATTGCATAAAGCTGGCATAG
AGGTTATTCTGGATGTTGTTTACAACCATACAAATGAGGCGGATGATGCTCACCCGTATA
TGACTTCTTTCCGTGGCATTGATAACAAGGTCTATTACATGTTAGACCTGAACAAAAATG
CTGAACTACTGAACTTCTCAGGCTGCGGTAAAACCATGGTTCCTGTACTCGTATACTAAT
TTATTTGGGACTTTACTCTATATCAATAACTGTTTTTACTGCAATCTAATACTAATTCTG
CTTTTGCTTAAGACCTTAAAGGATGTAATATATCTCAGTTTTACCTATGGACATCCAAAT
ACCAAATTATTAATTATATTTTCTGTTAAGCCTTTATTTATACAGCTTTACAGCTGGTTA
CTTTTAAGAAAAATGCTATGATTTATTTCTGAAATTACTGCTTGTGTATCTTGCTGATCT
AACATGTTTAATGACTAGATACTTACATATCACATGATTTGTTCAAAATTTTGAAAGTGT
AATTGTTTCACTTTTAAGTCTTAACGGTATGTTTTGGTTCAACCTAGGGAATACACTGAA
CTGCAACCATCCTGTTGTCAAGGAGCTCATTCTTGACAGCTTGAGACACTGGGTTGAGGA
GTATCACATAGATGGATTTCGATTTGACCTTGCAAGTGTTCTTTGTCGTGGACCAGATGG
TTGTCCTCTTGATGCACCTCCACTCATCAAGGAAATTGCCAAAGATGCTGTATTATCTAG
ATGTAAGATCATTGCTGAACCTTGGGATTGCGGCGGCCTTTATCTCGTAGGGCGTTTCCC
TAACTGGGACAGGTGGGCTGAATGGAACGGCAAATACAGAGATGATCTTCGAAGATTTAT
TAAGGGTGACCCTGGTATGAAGGGGGTGTTTGCGACTCGTGTGTCTGGATCTGCTGATCT
CTATCAGGTGAACGAGCGGAAGCCTTACCATGGTGTAAATTTTGTGATTGCACATGATGG
ATTTACTTTATGTGACCTTGTTTCTTACAACTTAAAGCACAATGATGCTAATGGAGAAGG
TGGCTGTGATGGATGCAATGACAACTTTAGCTGGAACTGTGGTGTTGAAGGAGAAACAAA
TGATCTGAATGTGTTAAGTCTGCGTTCAAGACAAATGAAAAACTTCCATGTAGCTTTAAT
GATTTCTCAGGGCACCCCAATGATGTTGATGGGCGATGAATATGGTCATACACGTTATGG
GAACAACAATAGCTATGGACATGATACTTGCATTAATAATTTCCAATGGGAACAGTTGGA
ACAAAGAAGAGATGGCCATTTCAGGTTTTTCTCAGAGATGATAAAGTTTCGTCACAGCAA
CCCAATATTAAGACGAGACAGGTTTCTTAATAAAAACGATGTCACCTGGCACGAGGATTG
TTGGGAGAACCAGGAAAGCAAATTTTTGGCATTCACAGTACATGATCACAACTCTGGTGG
AGATATCTATTTGGCATTCAATGCACATGACTATTTTGTGGACGCTGTAATTCCCCCACC
ACCACACCATAAATGTTGGAACCGTGTGGTGGATACCAACCTGGAATCACCAAATGATAT
TGTACCAGAAGGGGTGCCATTTACAGGACCAAAATACAGAATTGCTCCATACTCTTCCAT
TCTGCTCAAGGCAAAGCCTTAGAAAAGTTAGTAGTTGAGAGCATAAAAATAATGCCACCA
ATGCTGGCTTGGTTGGTTAATAACAGGTTGATCACATTAGCAGTCTGCACTTCAAAAAGG
CAACAGGTATAGAGAATGTCTAATAACAACTGCCGAATCATAGTTGGCTTTGGCAGATGA
GGCCACTTTTGGCATTCAGGAATTTCTTCCAGTTATTACTGTAGGAATGAATGGGCTAGG
GCTTAGGGCCCTCTGGGGGCAGCAAAGCTCGAGGTGTCGTCTCGGTTTCATGTGAGCGTG
ACCTGGCTATGGTCACCCTATCATTTATCAAGGTCCTGTTTCGTAATAATGTGTCATCAA
ACACTCAACTCCCATGAGAATGTATGCCAGCATCTATTTTGCTGGAAATTCATGAAAAAA
AGGAACAATGCTATTAGTCCC

CDS

1020 bp

>Os09t0469400-01 Similar to isoamylase-type starch debranching enzyme ISO3.
ATGACCGAGGAAAGAGGATGTACAATGTCTGATACTGAAATGCCATTTAAATATTCCTCT
GGTAAAGCCTTCCCATTAGGAGTGTCTCAAGTTGAAGGCGGGCTGAACTTCGCACTTTTC
TCTCAGCATGCTTCTTCTGTCATTCTCTGCTTAAAGCTTCCTGGGAGGGGAACTGAAGAT
GAGAAAGGTGCAGATGTTGTCGAGTTTGTTTTAGACCAGCAGAAGAACAAAACTGGGGAT
ATATGGCATGTGATAGTGGAGGGCTTGCCTGCTTCTGGTGTTCTTTATGGGTATCGTGTT
GGTGGCCCTCAAGGATGGGACCAAGGCCATAGATTTGATAGCAGCACTGTTCTTCTGGAC
CCTTATGCAAAATTAGTTTCTGGTCGAAAGTACTTTGGGGTTGCTGAAGAGAAGTCAAGC
CAGCATTTTGGAACATATGATTTTGATAGCTCTCCTTTTGATTGGGGTGATGACTACAGG
CTTCCGAATTTGCCTGAGGCAGATCTAGTCATATATGAAATGAACGTCCGTGCTTTCACC
GCGGATGAGTCAAGTGGCCTTGATTCGACTTCTCGTGGAAGCTATCTTGGTCTCATTGAT
AAAATCCCTCATTTGCTGGAACTTGGCGTTAATGCAGTGGAACTACTTCCTGTTTTTGAG
TATGATGAGCTGGAATTCAAGAGGTACCCCAACCCAAGGGACCACATGGTCAATACATGG
GGCTATTCTACGATAAACTTTTTTGCACCCATGAGCCGTTATGCTAGTGCCGGTGGTGGA
CCAGTGGCTGCTTCCAAAGAGCTCAAGCAGATGGTCAAAGAATTGCATAAAGCTGGCATA
GAGGTTATTCTGGATGTTGTTTACAACCATACAAATGAGGCGGATGATGCTCACCCGTAT
ATGACTTCTTTCCGTGGCATTGATAACAAGGTCTATTACATGTTAGACCTGAACAAAAAT
GCTGAACTACTGAACTTCTCAGGCTGCGGTAAAACCATGGTTCCTGTACTCGTATACTAA

Protein

340 aa

>Os09t0469400-01 Similar to isoamylase-type starch debranching enzyme ISO3.
MTEERGCTMSDTEMPFKYSSGKAFPLGVSQVEGGLNFALFSQHASSVILCLKLPGRGTED
EKGADVVEFVLDQQKNKTGDIWHVIVEGLPASGVLYGYRVGGPQGWDQGHRFDSSTVLLD
PYAKLVSGRKYFGVAEEKSSQHFGTYDFDSSPFDWGDDYRLPNLPEADLVIYEMNVRAFT
ADESSGLDSTSRGSYLGLIDKIPHLLELGVNAVELLPVFEYDELEFKRYPNPRDHMVNTW
GYSTINFFAPMSRYASAGGGPVAASKELKQMVKELHKAGIEVILDVVYNHTNEADDAHPY
MTSFRGIDNKVYYMLDLNKNAELLNFSGCGKTMVPVLVY*

5'UTR

chr09:17868256..17868668 (- strand) : 413 bp

chr09:17868099..17868163 (- strand) : 65 bp

chr09:17867949..17868009 (- strand) : 61 bp

CDS

chr09:17867940..17867948 (- strand) : 9 bp

chr09:17867514..17867671 (- strand) : 158 bp

chr09:17866938..17867031 (- strand) : 94 bp

chr09:17866078..17866314 (- strand) : 237 bp

chr09:17865898..17866002 (- strand) : 105 bp

chr09:17865601..17865705 (- strand) : 105 bp

chr09:17865387..17865521 (- strand) : 135 bp

chr09:17865200..17865286 (- strand) : 87 bp

chr09:17864746..17864835 (- strand) : 90 bp

3'UTR

chr09:17864334..17864745 (- strand) : 412 bp

chr09:17863790..17863889 (- strand) : 100 bp

chr09:17863155..17863255 (- strand) : 101 bp

chr09:17862755..17862806 (- strand) : 52 bp

chr09:17861866..17861928 (- strand) : 63 bp

chr09:17861262..17861351 (- strand) : 90 bp

chr09:17861096..17861168 (- strand) : 73 bp

chr09:17859211..17859290 (- strand) : 80 bp

chr09:17859021..17859125 (- strand) : 105 bp

chr09:17858822..17858920 (- strand) : 99 bp

chr09:17858517..17858578 (- strand) : 62 bp

chr09:17858298..17858409 (- strand) : 112 bp

chr09:17857352..17857884 (- strand) : 533 bp

FASTA

>Os09t0469400-01 class=Sequence position=chr09:17857352..17868668 (- strand)
GCTCCGCTCC ACCGCGTGTC CCACTCCCAC CACCCCCGCT CTCCCGTCCG TCCGCGCGCT TCCCCCCATG CGAGATCACC
GTCTCCTCCG CCTCCTCCTC GTTGGCTCGT CCTCTTCCCC CATCCGCCTC TCTCTCTCTC TCTCTTTCTC TCTCTCTCCA
GTCTCCTCCA CTCTCCTCTC TTCGAGAGCC GCTCGCGACG CGAGCCTCTT GGAGCGCGCG CCCTATAACT AGGCACCCGT
GTCCCCGTCC CGGATCTCCC CCCCACCCGT CGCTCCGCCC CGTCCCCATT TTGGATGGAT TCCATTGGTA TAAATCGCGC
CCCGCTGGGT TCCTCCTCCT CCGCCGCCGC CGTGACAGCT CGTCGAGGCA TCGCGCTCCG CCCGGCTCGC CGCTCCGTCG
CGAGTACGAA CCGGTGAGCG TGTGTTTCTC CCTCGCCTCC GCATTTTTCC CTCGGTTTTT GAGGCGGCGG CATTCTGATT
CTGCGCATGG TGATCCTGAG TGCAGTGTGG GTGTGGCGAC GATCGGCTTC GGGGACGCGT CTGGGCTCAG AGCGTGTTCT
GAGAAGGCAG GTGTCTCTAT CTCTGTTGCG TCGATGCCTC GTTTCCATGT TGATTTGGGT GTAATGATCC GAGCGTAATT
GGTGGCTGGT GTAGGTTAGG CGATTTGATT CTGTACGAAG CACCACGGCG AGAGCTCAGA ACGGGAACGC TGGGAGAAGC
ATGACCGAGG TATCTCACCA AGCTTGCAGT TGCTGGCCTT TATATTATGA TTTGATCCAT ATGTACGTTT TTAGGGATCG
CAATGCTTGA CACAATCATG GTATGTTTGT ATGTTCCCAG CTCCATGCAA ACATGTTCTG TATCTATAAA CTGGATCATG
CCACATTTTG CCATCTCTTT TAATTTTGCT TCTGATTCTA GGATGTGCCA TTTTGTCTTG TTTTTCTAAC TTTGTGTTCA
CCTTCTCCTT TCCTTATTTT TAATTATGTA ACCACAGGAA AGAGGATGTA CAATGTCTGA TACTGAAATG CCATTTAAAT
ATTCCTCTGG TAAAGCCTTC CCATTAGGAG TGTCTCAAGT TGAAGGCGGG CTGAACTTCG CACTTTTCTC TCAGCATGCT
TCTTCTGTCA TTCTCTGCTT AAAGCTTCCT GGGAGGTATA GCTTTACCTT TTCCTAAAAC TGTTGTGACC TTACTGGTTT
TTCTTTTTCT GATTATATGT GTACCTGTGG GTTCTGGTCT CTTAAAGTCT CAACTATGGC AACTGGCAGT TTTGTTGCAT
GTCATCTATC TCCTTGCTGT CATCTTTTTA TGAACTTGCT CAACATACTT TAGGTCTCAT ACTCTTACGA GATATGGCAA
ACTTGTTTTT CATGACCTTA CTACACGATA TTAAGCAGTT GTTATGCCTT TGACATAGAG TCTATGAAAT TTTGAATTCA
TTTTTCAAAT TTGACGCTCG AAAGGAAAAC TACTTTTCTG TTTTTCAGAC TACCATATCG TGAGTTGATT TGGAGTGTAA
GCCTGGTTGA AAACTTGAAA TAATCTCTTA CAGATTAACC TGTAATTTTA GCTTGTCCTT TCCACGGTAA CATGTTACAT
TCTCTATCTA ATATTCTCAC TCTAAACTGT TCCTCAGGGG AACTGAAGAT GAGAAAGGTG CAGATGTTGT CGAGTTTGTT
TTAGACCAGC AGAAGAACAA AACTGGGGAT ATATGGCATG TGATAGTGGA GGTACTGTCA TAGAATTTTT GTGGGTACAT
TTTAAAGTAA GAGTATCATT CTATATACAT CGACAAATCA CTGTGGATAA CTTTCTTGCA ACAAGTTGAA TTGAGTATTC
ATCTGATACA TATTTTGATT ATAGTTACAA TGTTTCATAT TCTTCAAAGT GAAACTTCAT TTTACAATGT GTTCATGGTA
TGGAGCCCTT CCACCGATTT GAGTCCTAAA GGACTGATTT GGGTGCTCAT CTCATTTATT TATTGTTAGA ACTCATGACC
ATTCTTTTAA AAATGCTCAA ATTTGAGAGG AACAGTACTG AAATAATATT CCTGATTTGG CCAAAACGTT GGCTTTGTGA
TGCTAACTTG TTTATCTCCA CTAAAAGGAA GAAGTGCTGA ATGGTAATCT TGGCTAGTTC ATTGCCTCAC TTCTAGGATG
CTTTCACCTC TGTTTGTTTG AGTGCCTGAC TCAATATTTT TGTCCATCTA TTATATAGTA GTCATGGAAG GAATAATCTT
CACCTGTTTT TCTTGTATGT AATTTGCTAT GCATATATGC TGCATTTTTT TTTGTTATTT CTATGCTTCA TTAAAACTGT
ACAACCTTAA AGAAATCTTC TCTATGACTT CCAGGGCTTG CCTGCTTCTG GTGTTCTTTA TGGGTATCGT GTTGGTGGCC
CTCAAGGATG GGACCAAGGC CATAGATTTG ATAGCAGCAC TGTTCTTCTG GACCCTTATG CAAAATTAGT TTCTGGTCGA
AAGTACTTTG GGGTTGCTGA AGAGAAGTCA AGCCAGCATT TTGGAACATA TGATTTTGAT AGCTCTCCTT TTGATTGGGG
TGATGACTAC AGGCTTCCGA ATTTGCCTGA GGTACTATTA TCATTTGGTA GGATTGACAA GATGTTCCAA ACATGAAGTT
CTCAATTTTT TGTTTCTTTA ATCTAGGCAG ATCTAGTCAT ATATGAAATG AACGTCCGTG CTTTCACCGC GGATGAGTCA
AGTGGCCTTG ATTCGACTTC TCGTGGAAGC TATCTTGGTC TCATTGATAA AGTAAGTACC ATTTTTTGTT TGTTTATGAA
CACAACTATT TGTTTGTATT TAGAAGATTT CCCTATTACT TTCTTAAATT TCTTATTTTT ATCATCGAGT TTAGTTACCC
TGTCCACTTT AAGAGGCTGA TTTCCTTCGC ATTTCTGTGA CTATTGCTTG TGACTTACAC ATGAAATAGT TTTGGTTTCA
TAGATCCCTC ATTTGCTGGA ACTTGGCGTT AATGCAGTGG AACTACTTCC TGTTTTTGAG TATGATGAGC TGGAATTCAA
GAGGTACCCC AACCCAAGGG ACCACATGGT AAACTTATAC ACTTTATCCA TGCTTAATAT CCATCGTAGT CACCATCAGA
GTGACTTTCT CTCTTCTCAA TTGAAAGGTC AATACATGGG GCTATTCTAC GATAAACTTT TTTGCACCCA TGAGCCGTTA
TGCTAGTGCC GGTGGTGGAC CAGTGGCTGC TTCCAAAGAG CTCAAGCAGA TGGTCAAAGA ATTGCATAAA GCTGGCATAG
AGGTATCCAA ACTCAATATA TACCAGCAGA TTTTACTGAT CATTGTTAAT TTCATGCACC GCCAGGATAA AATACATATA
ATGGCATCAC CATTTTGTGC AGGTTATTCT GGATGTTGTT TACAACCATA CAAATGAGGC GGATGATGCT CACCCGTATA
TGACTTCTTT CCGTGGCATT GATAACAAGG TGAACTTTCT AATTGTTTTG TTGCCAAAAA GAGCATCTAT ATGCTTCCAC
CTGTTCTTTC GACCAGACTG CACTTAGGGG TTAAAAAACT AGGTTAGCTA ATTCCAATGC AGCTAGGTTA GCGTAGCCCG
ACTTTTTTTG TTGTTCTTGG CAAGTTGGCA ACACCAGTCA TGCCGAACAA CTGTTTTGGC TTGATGACGT GGTTTACCTA
GTTAGTTTAA TCCTGTTTAG GACTTAAGAT GCTCAAAGTG CTTTCACCAG GTTAAATTAT CACGGGCACC ACCTAACCAC
CAGGTTTTGT TGGGTTAAAT TTGCTTATCA GGTTTTTGAC GAATTTATAT AAAAAGATGT CCTGTTCTTG CAGGTCTATT
ACATGTTAGA CCTGAACAAA AATGCTGAAC TACTGAACTT CTCAGGCTGC GGTAAAACCA TGGTTCCTGT ACTCGTATAC
TAATTTATTT GGGACTTTAC TCTATATCAA TAACTGTTTT TACTGCAATC TAATACTAAT TCTGCTTTTG CTTAAGACCT
TAAAGGATGT AATATATCTC AGTTTTACCT ATGGACATCC AAATACCAAA TTATTAATTA TATTTTCTGT TAAGCCTTTA
TTTATACAGC TTTACAGCTG GTTACTTTTA AGAAAAATGC TATGATTTAT TTCTGAAATT ACTGCTTGTG TATCTTGCTG
ATCTAACATG TTTAATGACT AGATACTTAC ATATCACATG ATTTGTTCAA AATTTTGAAA GTGTAATTGT TTCACTTTTA
AGTCTTAACG GTATGTTTTG GTTCAACCTA GGGAATACAC TGAACTGCAA CCATCCTGTT GTCAAGGAGC TCATTCTTGA
CAGCTTGAGA CACTGGTATG GACAACTTGC AGCTAAGATT TTTCTCATAA ATCCAATTGT GTGTAGATTC ATCCATATTT
CTTTGTTTCA TCTTGACTAT GTCGGCATTA TTCATAATCA AGTGTCAAAA AATATCTATA TCGATTTGAG CTTTCATGTT
GGTATGATCA GACCAAGATG ATGTATCGAC AGCCTAAAAT TATTCAAAAT TTCCTCTAGG CTATAGCACA TGCTTGTAGC
TATTTGGCTT GTAGCAAGAC AGTTGATATA TGAGAGATAG TTCATGGCTA TGTCTTATTG TGAACCTTGG AAAACAAGAT
AGCCAGAAAC TGCAACAAAA ACAGTTATTT TTATACAAAT AACTGAATTA TAGCATGCAT TTTTATTTTC TCTTTGACAA
TGGTTTTGTC ATATTTCAAA TGTCATTTCT AATCTCCATG CTTGTTTTAA TGCATCAAGG GTTGAGGAGT ATCACATAGA
TGGATTTCGA TTTGACCTTG CAAGTGTTCT TTGTCGTGGA CCAGATGGTT GTCCTCTTGA TGCACCTCCA CTCATCAAGG
TATAATGTAG ATGCAGACTT TAGGTTTGAA CACTAAATAT GTATGGCTGC TTACCAAGCC TGTGCAGACC GAATTTTGTT
TGTCTAAATA AGTGAATTTA ATAGATTTCA TGTAAAAACA ACCCGTACGT TACATTATAT GGATGATTGG ATGCAAATTA
TGATGTACTG AAGTACTGAA CTTCCAGCAA TCAATTCTAA TCAACTTTGC ACTATTGTTG ATTGTTTTCT TGTTTGCATG
GTTTTGTTCA TTGAATACAT ATCTAGTGCA AGCTCACAGG AATGCAATCA TGAAAATTTG CAATGTGGGC AGCTATATAA
GATACAGTAT GGACTAGATG TAGGGCTCTT GAGGTTCATT TGAAAGTTTT TTTAGTGACC CCCCTCAAAC GTTAGAAAAT
TGTATTTATG ACAAATTCCA CCTTTTCAAG ACCATCTAAA TCCTAATCCA TCAATCTCTG GTCATACAAC TCACGTTGAT
GTATCGAGAC TAGTGGCTTT TATGTTTCTT CATATTAATT TATTTGGTTG TAGGAAATTG CCAAAGATGC TGTATTATCT
AGATGTAAGA TCATTGCTGA ACCTTGGGAT TGCGGCGGCC TTTATCTCGT AGGGCGTTTC CCTAACTGGG ACAGGTGATT
TGAACACTTC TATATTTCTA TAAAAAGAAT TTGGTGGTAT AGATGTTTTA TCCTTGCTTC TTTTAGGACT AAAGATTTGG
TGATACAGTA ACACAAAACA GTAACTATTT TCTGTTATGG ATAATATCAT GCTGAGATGC TCATTCCTAA AGTACTTAAC
AACTGAATTC TTGAAATGAG AGAATTATTG CTAGTATCAC TTTTCTCATT GGACTTGGCA AACATGCTTC ATTGTGCGGT
TCAGTGACCT TTCCCTACCA TGCATACACA GATCAGTTAT TCTATAATGA GTTTCATTTA TTTTTAAAGG TATGGTGATC
ATGTTTAACA TTCCTCTTGC AGGTGGGCTG AATGGAACGG CAAATACAGA GATGATCTTC GAAGATTTAT TAAGGTAATA
TGCCGGGAGA GAAGATTTTT TAGAAAATAC AGATAAGAAA AATTGTACTC ACCTGCAATT TATGGTAGAG ATTTCATCAT
GGCAGTATAT CAGGAATTAC TGCTGAGGAA TAGGATTGTT ATGCCCTTAT GCTAATCTAT CATTCCCTTG CCTCATCCCT
TTCTGCCAGA GTATTTTAAT TAACCATGCC ATAGGATAGT TATTTTACTG AGCATGTTAA TGAAGTTTAG CTTCTCACTG
TACCTATATT TAGTTTTAAT TGTCCTTGAT GGTGTATGAA CATTAGCGGC AAACTTAGGT TATTGTGGAA CAGCCAATGG
CTAGGAAACA TGGAGATTTT GTTAAATGTT TAACTAGATA TAGGATCAGT ACCCTTGCAA AATCAGTATT TTATTTAATT
TAATGGGCAA TTCTGAAGCA TACGATCACA GTTCCGCATA TTATTTGAGA AAATGGCAAC ATACTTTTAT GCAATAGCTC
TGTACCAGTT GTGTAAAGAT TACCAGGTTA CTGAAACATA GGGGTAGAAT TAGGTGGCTG CAGTTTCCCA AACTCTGATC
TTGGCTATCC ATAACTCCAT TCTTGAGCCA AATATTTAGA TGATCTCCTT CAGAACTTGA GCATAATTTT TTTTAACCAT
TTCAAACATC AGTGAGTTTT TTCAACTGAA GATCTGAATT TACTGAACAT TCTGCATTTT ATCAGTGCTT GCCTAGCATA
GCCATGAGAA TTCTTCTGTT TGTGTTCTTT TATTCTTGTT TCTATAATAA CGACCGAATG ACTGATTGGA TGCTGCTAAA
CATTTGGAGT TGTTTCTCAG GGTGACCCTG GTATGAAGGG GGTGTTTGCG ACTCGTGTGT CTGGATCTGC TGATCTCTAT
CAGGTCCCCC TCTTTTAGAT GTTATTTTCC CTTTACTGTT ATTTTTTATC CATTTGCTTA GGATATCGCT TGTTTTTGAA
CTTTGATCCC CCCCCACACA CACAAAATAA ATAAAATAAA AATCCATTTC CAAACAAGAG CGGCTTCCAA AGTTATTGCT
AATAAGTTTA GGTTTAATTA CATGCTTGTT ACTTTTGTAT CACTGTTAGA GCATAGGTCA TTATCAACAT TTAGCGTGCC
CCAAATTCTA TCATGTCAAT TGTGTTAGTT CAGTAGGATT TCTCCAGTAT CCAATTGTTT AATGGATATA AATGTATTCA
GGGTCTAGTG ACATACCATT TGATAGTGCA AAACACAGTA TGGTATGATG CCACCTATTA TTTCATTTTG TGAGGATGTG
TAAGGAACCT CTGTGGACAA ATTTTTAAGA ACTACTGTTA CACTGAAGGG GTTCAGACTC AGTTATTTTT TGTCAAGAAA
CAAAAATATG TAAAATAAAA TTCACCTGAT GTGGCAGGTG AACGAGCGGA AGCCTTACCA TGGTGTAAAT TTTGTGATTG
CACATGATGG ATTTACTTTA TGTGACCTTG TTTCTTACAA CTTAAAGGTA ACTGGAGTAA GCTAAGCAGT TTAGTTAAGA
TCATTTATTT ATACTGTGAA GTGTATGCTA ATCTGCCTTC TTTTTATCAA AATCATATAG CACAATGATG CTAATGGAGA
AGGTGGCTGT GATGGATGCA ATGACAACTT TAGCTGGAAC TGTGGTGTTG AAGGTACCTG CTTTACCGAA TATCTATTTT
CTTTTGTACA TTGAAATCAT GATTCCATGA AACTGCAAAA AGATGCTTAT TTTCATATCC CATCAAATTG ATACATCTGA
CTGATGTAGG GTACTGTAAA GATAGAAAAC TTGGTCGAGT TTATTATTAA AACAACCCTT TGTATGAATT AAAGGTATAG
TCATAAAGAG AATGACATAG TTTGATTTTG TTGAAATTTA GTGTCTTGTA TTGATTTTGT TGAAATTTAA TGTCTTGTAA
TTCAACAGAA CTAAAAGATT GCCCCTAGTA GTGAAGCTTC AATGTCAAGA TGGATCCAAA TAGCTCTATG AGCTGTGCAG
AACTTTCCAA ATGCAACCAT AGATGGCTAT CCCTCTTTGA ATCAGAAATA ATTATTTtta gggttaattg gatccatgcc
actgcaaatg tggcaaatca aaaaaatgcc acacatattt gcgttatcgg ctggatgcca ctgcaaattt ttaaaataag
aaccatgcca ctccatcacg atttccgtcc aatccgtcac attttccgcc gtctccgtct tcgtcctctc gtcgtcctcg
tctCGACGGC AGCACCAGCA CGGCAGTACG AAGGCGGGCG CGGATGGCAG CACGGCGCAC GGCGGCACGG CAGCACGGTG
GTGGATGGCA GCACGGCACC GGCGACGGTC GTGCCCGCGT CCGCTCCCCG CGCCCCTCCG CGACCTCCTC GCCGACTTCC
TCTCTCTCCA CCGTTGCAGC CGTCGTCGTT GACCATTTCC GCGGTGGACC CGCCGCCGTT GACCTCATCT GCGCGGGAGA
GCTCGGGAGC CGCCGCCGCC GTTGCTGTCC TCGTCGTGGT CGTCGACGAG CCGCACCGCC TCCGCCCAGA TCTGGCGAGG
AGGGCCGCTC GTCGTTGCTG CCGATGGAGG AGGCGTCGAG CCTCGAACTC CGCCGCTGTT GGCCCCAAGC TTTGTCACTA
GTGCTGCCGA CGcccatctc ctctctccac atgaccatcc tcggcagcag ctgcgccccc tccgcgacct ccccgcgaag
cgtcctcgtc ggcggcggcg gcctcgctcg cgaccgtcct cgccggtagt ggctatgccc gcgtccgcct ccacggccgt
cctcggcagc agctatgccc cctccccgac ctccccgcga gcgtcctcgc tggcggcggc tacgcccgcg cccgcctccg
tgaccttcct cggcggcggc catgcccctc cgcgaccgtg ctcgtcggcg gcggcaaaga tcgatggttg tatgttgatt
ggtttagtta gctagctagc tagcctcgcg cgctgcatct gtagcagcta gctagctact ccctgagctt gttgggtgtt
tctgcctgag ctccattccg cgccgaaccc cgtcaggccc ggccgcgacc gcgccgggct gtcctccgcc cgtgccagcc
gtcgcgccag ctccccatcc tcttctccgt tttgccgcgt gaagccgatg cgttttgtcg cgtgcgcctc atcggcttcg
actccggtgg ttgagctgct cacacgcgtc cgggggcagc agaagtgaga gagagagaga ggaggacgga aatcgtgatg
gagtggcatg gttcttattt taaaaatttg cagtggcatc cagccgataa cgcgaatatg tgtggcattt ttttgatttg
ccacatttgc agtggcatgg atccaattaa ccctTATTTT TAACCTAATG CTATGCGAAA TGTTTGATGT TAGAATTGAT
GCTCTTGTTC TGTAACAGGA GAAACAAATG ATCTGAATGT GTTAAGTCTG CGTTCAAGAC AAATGAAAAA CTTCCATGTA
GCTTTAATGA TTTCTCAGGT AAACATTGTG AAGTAACCTA CAGTTTATTT TATGTGTGCA TCATGTATAA ACTTATCACA
TAATCACCAT TTTCATATAT CAGGGCACCC CAATGATGTT GATGGGCGAT GAATATGGTC ATACACGTTA TGGGAACAAC
AATAGCTATG GACATGATAC TTGCATTAAT AATTTCCAAT GGGAACAGGT TGCATTACCG TAACTATTTT AGTTTTCAAC
CAGGAATATG TTTATGAATT TGGCAGATCT ATATATAATT TGTTTTCTCC GAATCCATGT GAATATAGTT GGAACAAAGA
AGAGATGGCC ATTTCAGGTT TTTCTCAGAG ATGATAAAGT TTCGTCACAG CAACCCAATA TTAAGACGAG ACAGGTTTCT
TAATAAAGTA AGTAATACCT AGAAGTGCTA TCATTGCAAT TAACTGGTTT ATTGAAGACA ATCATTTCAT CATCTTCTCA
AAAAATAGCT GCTGGTGTCT GTCGAAATTC CAAGTATATT TTCTCAGTCA AGTCTGATTA GAATAGTATA ATACAGCAAA
TATACACTTT GCAGCTTTTG CAGTTGCATC TCTTAGTTTT TTTTTCGTCT CAAATGTTCT TCATTGTATT GTGATCTTCC
TTGTTGGTAG AACGATGTCA CCTGGCACGA GGATTGTTGG GAGAACCAGG AAAGCAAATT TTTGGCATTC ACGTAAGTTT
GTTGATCACT TTCGTTTATG CACCTTATTA TGGTATTTGT TTATGATGCT CCAAAATCCA AATTCTTGGC TTCTGACTTT
CATTGCCATT TTACTGTAGA GTACATGATC ACAACTCTGG TGGAGATATC TATTTGGCAT TCAATGCACA TGACTATTTT
GTGGACGCTG TAATTCCCCC ACCACCACAC CATAAATGTT GGAACCGTGT GGTATGGATA CTTTTCAGCA TTGCTAAATT
TCTTACGTAT AGTAAAGTAA ATTCCTACAT AATCCTAGCA TGGTGTGGTT GTAATTTCTA AATATGTAGA AGTGCTGCCA
GTACTCATTC TGAATTTTAC TACATTAGAC GCTCGGACAA ATACCAACTC TTAAAAGAAG ATATACAAGT TTCCACAAAA
TTTCTCAGGA ATAGACATAG GTAGTACTGA TACAGTTCTA CAACCAAAAG CTGTATACGG TTGTTACTTG TGCTAGCAAT
CCTGCTAAAA CTGGTTTGGA GTTTATTGCT CATTAGCTAC TTTTAATTTT TACAATGATT GGTCTGGCTG GATTTGATCA
CTCTTTTCTC ACACCTTTCC GCTCCTATTG TCATTCTAAA TCTGCTCTAA TAATCTTTTT GTAGGTGGAT ACCAACCTGG
AATCACCAAA TGATATTGTA CCAGAAGGGG TGCCATTTAC AGGACCAAAA TACAGAATTG CTCCATACTC TTCCATTCTG
CTCAAGGCAA AGCCTTAGAA AAGTTAGTAG TTGAGAGCAT AAAAATAATG CCACCAATGC TGGCTTGGTT GGTTAATAAC
AGGTTGATCA CATTAGCAGT CTGCACTTCA AAAAGGCAAC AGGTATAGAG AATGTCTAAT AACAACTGCC GAATCATAGT
TGGCTTTGGC AGATGAGGCC ACTTTTGGCA TTCAGGAATT TCTTCCAGTT ATTACTGTAG GAATGAATGG GCTAGGGCTT
AGGGCCCTCT GGGGGCAGCA AAGCTCGAGG TGTCGTCTCG GTTTCATGTG AGCGTGACCT GGCTATGGTC ACCCTATCAT
TTATCAAGGT CCTGTTTCGT AATAATGTGT CATCAAACAC TCAACTCCCA TGAGAATGTA TGCCAGCATC TATTTTGCTG
GAAATTCATG AAAAAAAGGA ACAATGCTAT TAGTCCC

Locus: Os09g0469400

Loading...

Locus: Os09g0469400

Loading...