Os09t0469400-02

Locus

Os09g0469400

Description

Similar to isoamylase-type starch debranching enzyme ISO3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ISA3

CGSNL Gene Name

ISOAMYLASE 3

Oryzabase Gene Symbol Synonym(s)

OsISA3

Oryzabase Gene Name Synonym(s)

isoamylase-3, isoamylase3

Transcript Evidence

AK106986 (DDBJ, Best hit)

Protein Evidence

NP_001105198.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycosyl hydrolase, family 13, all-beta (IPR013780)

Alpha amylase (IPR015902)

Full-length cDNA

002-120-A01 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0469400-02)

RiceXPro (AK106986)

Others

Oryzabase (6180)

KEGG (Os09t0469400-02 (EC:3.2.1.-))

Transcript

1925 bp

>Os09t0469400-02 Similar to isoamylase-type starch debranching enzyme ISO3.
AGTTGGAACAAAGAAGAGATGGCCATTTCAGGTTTTTCTCAGAGATGATAAAGTTTCGTC
ACAGCAACCCAATATTAAGACGAGACAGGTTTCTTAATAAAAACGATGTCACCTGGCACG
AGGATTGTTGGGAGAACCAGGAAAGCAAATTTTTGGCATTCACAGTACATGATCACAACT
CTGGTGGAGATATCTATTTGGCATTCAATGCACATGACTATTTTGTGGACGCTGTAATTC
CCCCACCACCACACCATAAATGTTGGAACCGTGTGGTGGATACCAACCTGGAATCACCAA
ATGATATTGTACCAGAAGGGGTGCCATTTACAGGACCAAAATACAGAATTGCTCCATACT
CTTCCATTCTGCTCAAGGCAAAGCCTTAGAAAAGTTAGTAGTTGAGAGCATAAAAATAAT
GCCACCAATGCTGGCTTGGTTGGTTAATAACAGGTTGATCACATTAGCAGTCTGCACTTC
AAAAAGGCAACAGGTATAGAGAATGTCTAATAACAACTGCCGAATCATAGTTGGCTTTGG
CAGATGAGGCCACTTTTGGCATTCAGGAATTTCTTCCAGTTATTACTGTAGGAATGAATG
GGCTAGGGCTTAGGGCCCTCTGGGGGCAGCAAAGCTCGAGGTGTCGTCTCGGTTTCATGT
GAGCGTGACCTGGCTATGGTCACCCTATCATTTATCAAGGTCCTGTTTCGTAATAATGTG
TCATCAAACACTCAACTCCCATGAGAATGTATGCCAGCATCTATTTTGCTGGAAATTCAT
GAAAAAAAGGAACAATGCTATTAGTCCCATGAAGTATGAACATATGTCAGTGTGTATTTC
TTGCATGATGCAGAGGCTGCGATATTCTGCGCCTGCACCTCCCGGTACGGGCTGCGGCGG
CAGGCTCCCGACTGACGGCGACCCCGGTTGGTACGGAGGGAAAGCTTCCACATGTGCAAC
GGCGGCAAGCTACAGTGTTCCCAGGCAGGCACCAACCTGTTCTCCAATGCAGCCAAGAGA
AGAGCCAGCTTCGACTTGACAAGATAACATGGCCATTTGACAGAGCTGGGCCAGCCGGTG
CTGCTCTTAACCAAGGCATGTGAAAGGTTAACTCGCCTCTCCTGCCAATCTCACCTGAAT
ATCAAGCGCCTACAGTGCAGCCTGAGCCAGCATCATCGTACCAGCAGATCAGATCTTTGA
GCCCCCGTTTTCGTTTGGGTTATGTACACGTACTGCAGCCGATCGATCCGTTGCTGTACC
GATGGATCTGAGCTGATGATGCACTCACTGTGCTCCAGATCTGGTCGATCTCCTTTAATA
CTCCCATCTAAAAATAAGAGGAATTATTGGTACGTACGCTGGCGCAGTATTTCACAGCAT
TTCCGGTGGGATTTTCGCTCAGCTGCGTCGATCCCGTGAGGTGAAAAGGCCTGTAGCTAG
CCAGCTGGGGAGCAGCGAAAGGCAGCGATAGATTACGGGCACCGGGTCGGTCGGTGGGGG
CGCCGCACGATGGCGAGATGTCGAGACGAGGCGAGGCCCGCGCGGCACGTGCCGGTGGTG
GTGCCCGATCCTCGCGGCAGCGACAGCCCGCAGACGGCAGAGGCGGAGGCGCAACGCGAG
CGGAGGCGGACGCGACGCGACGCGCGCGTGGGTTTCCCGGTGTTTTTGCTGTGTTTTTTC
TCCCGTCCTTTTCGTGCGGGCGGCGGTTTGCGCGCGGTGCCGGCTTGCGGCTTTATTTAG
CTGTAGGCAAGCAAAGGGGGGGGCAGCGTCACGGACGGCTGCGTGCGGCGCGGCAAGCAG
CAGCACAGCAGATGCAACGCGGGGTCGTCAGCTGTTTAGGTAGTTCGTTCTCTCTCCTTT
TCTAACTTTTACTCACTCACGTCCAAAAAAAACAATCGATGTGAATGCGATTTCAGTTTG
GTTGT

CDS

387 bp

>Os09t0469400-02 Similar to isoamylase-type starch debranching enzyme ISO3.
TTGGAACAAAGAAGAGATGGCCATTTCAGGTTTTTCTCAGAGATGATAAAGTTTCGTCAC
AGCAACCCAATATTAAGACGAGACAGGTTTCTTAATAAAAACGATGTCACCTGGCACGAG
GATTGTTGGGAGAACCAGGAAAGCAAATTTTTGGCATTCACAGTACATGATCACAACTCT
GGTGGAGATATCTATTTGGCATTCAATGCACATGACTATTTTGTGGACGCTGTAATTCCC
CCACCACCACACCATAAATGTTGGAACCGTGTGGTGGATACCAACCTGGAATCACCAAAT
GATATTGTACCAGAAGGGGTGCCATTTACAGGACCAAAATACAGAATTGCTCCATACTCT
TCCATTCTGCTCAAGGCAAAGCCTTAG

Protein

129 aa

>Os09t0469400-02 Similar to isoamylase-type starch debranching enzyme ISO3.
LEQRRDGHFRFFSEMIKFRHSNPILRRDRFLNKNDVTWHEDCWENQESKFLAFTVHDHNS
GGDIYLAFNAHDYFVDAVIPPPPHHKCWNRVVDTNLESPNDIVPEGVPFTGPKYRIAPYS
SILLKAKP*

5'UTR

chr09:17858921..17858922 (- strand) : 2 bp

CDS

chr09:17858822..17858920 (- strand) : 99 bp

chr09:17858517..17858578 (- strand) : 62 bp

chr09:17858298..17858409 (- strand) : 112 bp

chr09:17857771..17857884 (- strand) : 114 bp

3'UTR

chr09:17856990..17857770 (- strand) : 781 bp

chr09:17851431..17852185 (- strand) : 755 bp

FASTA

>Os09t0469400-02 class=Sequence position=chr09:17851431..17858922 (- strand)
AGTTGGAACA AAGAAGAGAT GGCCATTTCA GGTTTTTCTC AGAGATGATA AAGTTTCGTC ACAGCAACCC AATATTAAGA
CGAGACAGGT TTCTTAATAA AGTAAGTAAT ACCTAGAAGT GCTATCATTG CAATTAACTG GTTTATTGAA GACAATCATT
TCATCATCTT CTCAAAAAAT AGCTGCTGGT GTCTGTCGAA ATTCCAAGTA TATTTTCTCA GTCAAGTCTG ATTAGAATAG
TATAATACAG CAAATATACA CTTTGCAGCT TTTGCAGTTG CATCTCTTAG TTTTTTTTTC GTCTCAAATG TTCTTCATTG
TATTGTGATC TTCCTTGTTG GTAGAACGAT GTCACCTGGC ACGAGGATTG TTGGGAGAAC CAGGAAAGCA AATTTTTGGC
ATTCACGTAA GTTTGTTGAT CACTTTCGTT TATGCACCTT ATTATGGTAT TTGTTTATGA TGCTCCAAAA TCCAAATTCT
TGGCTTCTGA CTTTCATTGC CATTTTACTG TAGAGTACAT GATCACAACT CTGGTGGAGA TATCTATTTG GCATTCAATG
CACATGACTA TTTTGTGGAC GCTGTAATTC CCCCACCACC ACACCATAAA TGTTGGAACC GTGTGGTATG GATACTTTTC
AGCATTGCTA AATTTCTTAC GTATAGTAAA GTAAATTCCT ACATAATCCT AGCATGGTGT GGTTGTAATT TCTAAATATG
TAGAAGTGCT GCCAGTACTC ATTCTGAATT TTACTACATT AGACGCTCGG ACAAATACCA ACTCTTAAAA GAAGATATAC
AAGTTTCCAC AAAATTTCTC AGGAATAGAC ATAGGTAGTA CTGATACAGT TCTACAACCA AAAGCTGTAT ACGGTTGTTA
CTTGTGCTAG CAATCCTGCT AAAACTGGTT TGGAGTTTAT TGCTCATTAG CTACTTTTAA TTTTTACAAT GATTGGTCTG
GCTGGATTTG ATCACTCTTT TCTCACACCT TTCCGCTCCT ATTGTCATTC TAAATCTGCT CTAATAATCT TTTTGTAGGT
GGATACCAAC CTGGAATCAC CAAATGATAT TGTACCAGAA GGGGTGCCAT TTACAGGACC AAAATACAGA ATTGCTCCAT
ACTCTTCCAT TCTGCTCAAG GCAAAGCCTT AGAAAAGTTA GTAGTTGAGA GCATAAAAAT AATGCCACCA ATGCTGGCTT
GGTTGGTTAA TAACAGGTTG ATCACATTAG CAGTCTGCAC TTCAAAAAGG CAACAGGTAT AGAGAATGTC TAATAACAAC
TGCCGAATCA TAGTTGGCTT TGGCAGATGA GGCCACTTTT GGCATTCAGG AATTTCTTCC AGTTATTACT GTAGGAATGA
ATGGGCTAGG GCTTAGGGCC CTCTGGGGGC AGCAAAGCTC GAGGTGTCGT CTCGGTTTCA TGTGAGCGTG ACCTGGCTAT
GGTCACCCTA TCATTTATCA AGGTCCTGTT TCGTAATAAT GTGTCATCAA ACACTCAACT CCCATGAGAA TGTATGCCAG
CATCTATTTT GCTGGAAATT CATGAAAAAA AGGAACAATG CTATTAGTCC CATGAAGTAT GAACATATGT CAGTGTGTAT
TTCTTGCATG ATGCAGAGGC TGCGATATTC TGCGCCTGCA CCTCCCGGTA CGGGCTGCGG CGGCAGGCTC CCGACTGACG
GCGACCCCGG TTGGTACGGA GGGAAAGCTT CCACATGTGC AACGGCGGCA AGCTACAGTG TTCCCAGGCA GGCACCAACC
TGTTCTCCAA TGCAGCCAAG AGAAGAGCCA GCTTCGACTT GACAAGATAA CATGGCCATT TGACAGAGCT GGGCCAGCCG
GTGCTGCTCT TAACCAAGGC ATGTGAAAGG TTAACTCGCC TCTCCTGCCA ATCTCACCTG AATATCAAGC GCCTACAGTG
CAGCCTGAGC CAGGTAAAAA TCCCTCCTAT CTCAATCATT GTCAACCACC TTCTATCAGC TAGGTTCCAA ACAGAGGGGA
AGGAAATGAA CGGCCGGTGT ACTTAGCTCA GCTGTCCTGT TGCTGAAGGG CCCAGACCCT GGGGGTGGGA CATACTACTC
CTTTGCAAGC TGTGGGCTGT CCTTATGATT TGCTAGTTAT ATATGTCGAA GGGCAGCCGC TTTATTAGTG CTAACCACCT
TTTAGTTTAT GGAGTATGGA ATTTGGCAAC CTCTTTAGGA AAATATTCCT AATCATTCAT CAATGACCAA GGAACCACCC
TAGTGCATAA TTATGTCAGT CTGGTTTCCC AACTGGCTTT CAGGGGGAAT ATATAAGTCC TTCATAATCA TACCAACTGC
TAAAAACTTT ACACTGCTAG TAATAAAATT GATAACAAGC TTTACACAGC TTAATTTGCT GGTAGAGGTT GAACCCTGTC
TGGTGGAGCC CGGCCTGAGG TTTTAGGCTC TAGAAAATAG CTTAATTAGG TACCGAGTCA AGGTGAAGAT AGTGTGGTTG
ATCCAAATCC AGCCTTGCTC CCTAAGTTCC TCAAAATTAC TAACCGGCGC CAAGCAGCTG AACTCAAGCT TTTTCAATAA
GAATTTAGTG AGGTATTTGA GGTCTCAATA TACCTTATGT CAGATAGCTG CCAAGAAATA CAAGCAAGAA AACATAACAT
ATGCCCATGC ATGTCACACC TTCATAACTC CAAGTATCTA GATTCGGTAC TATTCCTTTT GAAATACTCG AACCACCCAA
CGAATTGGTT attcctaaac aagtcatgaa aggaatgacg aacatacGGA TAAGATTTAC TATCAACCTC TCTTTTCGCG
TTTTGTTAGG GGCACACTCA CAGTCACAAT TCATCTTCCG TATAATCGAG AAAGAAAAAA CACTATGCAA ATCACTAAAT
AGAGCGACTC AACATGCTTG GGGATAAAGA TACTCTAGTG ACCTGTATGC TGACCTCTAC CAGACTCTAA CATCCGCCGT
CCACGCGTCA TCGCCGAAAT ATTCCAACTG TACCACACCA TATACATACA TACTACAGTC AGGACTTCAT GGGCGTACAG
GCCATGGACA ACATGTTGGC ACAACTTATA TGATCTTGCA GAGACTTTGT GGTTGTCACG TAGCCGGCTC GGCGCCACGA
AGTCGTACGT TCACCTGGTA GGATAGTTGG TACATCGGTG TCACGTAGCA TGCACTGGAC ATCCCTGCTG GAATATTACA
CCCTGGGCAT AGCCCACGTT GATAGAACTG ATCGAACGAA CTCGTGCTTT TGAAGATCGA TCTGCTGTTC TTAATTTGGT
TGTTAAGTTG GACAGATTGC GATGTCGATC ATTCCATGGA CGATATTTTC GGATCATTCT GAAGAATTTG TTTTTTAGAA
GGATCATACC GAAACATTTG TAGCAACTCA TCATGTGCGA CAACAATAAA ATTGTGATTT TGTTGTCGAA TCCGGAAGGT
TGGAAGCGAT GCCAAATTGC GCGTGATGTT CGTTGCTCTG AAATGCAAGG TTTCTTGCAA CGGGCCTGCT TGGAATAAGG
ACGACCTTAC GCTGCTCAGG AATATGAATA TTGTGATGGA GTGGAAGTTT AGGTTTAGTA TGGTTAGGCT GGAAATCACT
GAAATTATCT TGTGGATCAA GTTGAACATT GTGAAAGAGT AGAGTTTTAG GTTCTGGAAG GATTTAGGTT GGAAGAAACT
GAATAACACT CTATACCTTC CCTTTTTTGA AAAGCTTGGA TATACTATAT ACTTTATGGG TTGAGTTGAG TTTTGTGTGG
GAGTGGAACT AAAGGTTTTG GGAGGGTTCG GTTAGGTTGG AAAGTGGAAA CAACTGAATT TATCTTTGGG ATGAAGTTTT
TAGTATTGCT AACACAAGAA Atgttatgaa aataaataca cagcagatac atgattcttt tacatgggaa actcttacga
aaaaacaaca cgtaccaatt agcaatcatc attatttagg agttggttac aaatgcatga aaataattgt ataacaacac
tcctcccgta caacatacaa gaatatatat aaagaaaaaa tcaattataa ttggtaaaga tttgaagttc tattaaaaaa
ctaatcTTGT AGTACCACTG TTGTAAGAAC ACATTCTTCA TAAGGGGAAA AGGAACTTTT TAAAATCTTG GTGAACACAA
ATGAGAATAG AAGAACTTGT AAACCAATCA AGGTGCATGT GTCAACTTGG TTAGGAAAGT ACATTATTGG GAAATAAGTT
TGGTACTAGC AAGATACTCA ATTCCTTCTT TTGAAATCTT GTAGGAGTAT ATGTCGGTGT GTTTTGTGCA TCATTTTGTT
CTCTCGAAGA ACCAAATTAT TTTGAGAGAA GGGCAATAAC AATCAATCAT CTACAGATTC ATCAAATAAA AATTAGAGAA
TGCATGCAAC ATGGGGCTTC ATTGATTAGT TTCCAAGCCA ATCATGTCCT TTCAAAGGAT TTCGTTAGGC AACTAATCTT
AGCTGGGATG GTGCCATCAT AAACTAAGCA AACCTTGACT GTTTTATGTT ATCTGCGAGC AGTAGCAGTA CGTGCCAGCA
ATTTGTCAAG CCTGGTTAGT CTCATGAATG TTTTTCCCGA TATTATCAGT ATAAAGATTT GTTGGTATGA AAATAATCAT
TCAGGCTTTC CACTAAAACA AGTGTTGGAT CAAGATCATG CATACTACTA TAAAACATGC GCACTGTTTG CCCCTCATGA
AATTTGAAAA GGTCCACCTA TTCGTACTAG AATATTTCAT AATCGGCCGT GAAATTTGAT GAAGTCCACA TATTAGTACT
CGAATATTAC AACACCGCTG GTACTATAAT CTTTCAACGT TTATCATCAT CAAAAAGGAA AACGGTCACA TGGCTATACA
ATTGACGGTA TGATTTTTTT TAAAGTTTCG ACTTGTAAAT TTTCTTTAAA TCATTGGATC GTGTTGAGAT TCATGGAGGG
AAGGGAAGAA AAATTCCCAT GTCACTTGTG AGGCTAAGAG TGTCAAACCA GCAACCTCAT AGGTAAAAAT GTGCCTCGCT
AGCCAACCGG CTACGCATGG TTTGGTTTTT GTTTAATAAT ATGAGAGTTT TGTAGAACTT ATATTGTAAT TATAATATAT
TTACAATACA ATTACATTAT GATTATTATA TAAATAGTTA CTTTTAaaag tttttcactt gaatattata taaatagttt
ctttatctaa gcttcaaaaa ctaaaattag gtccgaccaa acgtttagta attcacCCAT ATTCATAATA GGCAACCCCA
ATAATCACGC AAAAATATAT AAAACAATTT TTGAGATAGA AAACATGTGA GAAAGATTTT CTACAATTTT GAGGAGCTTC
CAgcctcatc tttttcttat acttaaattt gactttttaa tcttagattt ggagttaatt ttagatgttt tttcatcgta
gtttattttt taaactttgt tttttgtttt tagatcgcta aaaacagtat ataaaagttt tatatacaaa ttatttttta
tttgtaaata tactgtttgg cttatacccc caataatccc aacgatgggg ccgTAACACA CTTGGGATGA TTCGGATGAA
GCTTCCTGTC TCCAGGAAAA GAAAGGTTTA AAAGCTTGCA AAATCCAAAC CGACAATCTG CAACAAAACT GCATCTCGAC
CGTCAAATTC CGATCCAACG GAGAGTGTTG GAAAATTAGC ACTAAACCCC CTGATAATAC CTGTATTTTT CATGTAGTAA
ACCACATCTC CTACAGTTCT ACTTCTTTAT AAGCTCCCCT ACCTCTACTG TCTCGGACAC CATTACAGTA CACCACCTCA
AGCTAGTAGC CACCTTCTCC CCAAGCACAC ACTCTCCTCC CAAACCCTAG CACCAGCTAG CTCTCTCACT CTACTCCAAT
GGCGCGCTTC CAGATCGTGG CCTTGGCCAT GGCGATGCTC TTCGCCGCCG CATCAGCTCA GGCCCCGGCG GCCACCCCGA
CGCCCGCTCC CAAGGCGTCC CCTCCTCCGG CGACGCCGCC GCCGACGCCT GCGCCGGTGT CAGCGCCCCC GGCTCAGGCC
CCGGCCACTC CTCCCCCGGC TCCGGCTCCC GCCCCCAAGG CCTCAGCTCC GGCTCCCGCC CCCAAGGCCT CGGCTCCGGC
TCCCGTGCCC GCGGCCGCGG CTCCCACCCC GGAGATCAGC TCGCCACCAG CCCCGTCACC GGCAGGCTTG GCCCCGTCTC
CCACCGCCGA GGTGACCCCT CCCCCCAGCG CCGCCGCCGG CGTCTCCCCC GCCGCCGCGT GGGTCGCCGC CGCCGCCGTG
GCCGCCGCCG CCGCGTTCTA CTGAGATCGA GGCTGATGAG ATCCGCCGAC CACCTCATTA ATTTATTACC CGTCCATCAG
AGGGACCCAC CATTCCTCCT CCTCCTCTCC TGATCTCCTC CTTTTCCTTC TTCATCTGTG GTGGTGGTGT TGAGCTGTTT
ATTTTATTTC TCTCTCTATC TTTTTTTTCT TCCATTTTTT TGGGCATTTT TTTTCCATTC AGGCATTCGA TTCAGTAGGT
GTGTGGGCGT GTGGCGTGGA CAGATTGGTT GGTTGGGTTG GTGTTGTGCT GCTCCTCCAT TGTACTATAC ATCTCCCGTT
GTTCAATATT CCTTTCACTT TGGACTTTTT ACTCTCTTTT ATTTTCCCCA AGCGCACTCA CCCCATTTTT TTAATCTTTC
TCCATTACCC CTTGCAGCAT CATCGTACCA GCAGATCAGA TCTTTGAGCC CCCGTTTTCG TTTGGGTTAT GTACACGTAC
TGCAGCCGAT CGATCCGTTG CTGTACCGAT GGATCTGAGC TGATGATGCA CTCACTGTGC TCCAGATCTG GTCGATCTCC
TTTAATACTC CCATCTAAAA ATAAGAGGAA TTATTGGTAC GTACGCTGGC GCAGTATTTC ACAGCATTTC CGGTGGGATT
TTCGCTCAGC TGCGTCGATC CCGTGAGGTG AAAAGGCCTG TAGCTAGCCA GCTGGGGAGC AGCGAAAGGC AGCGATAGAT
TACGGGCACC GGGTCGGTCG GTGGGGGCGC CGCACGATGG CGAGATGTCG AGACGAGGCG AGGCCCGCGC GGCACGTGCC
GGTGGTGGTG CCCGATCCTC GCGGCAGCGA CAGCCCGCAG ACGGCAGAGG CGGAGGCGCA ACGCGAGCGG AGGCGGACGC
GACGCGACGC GCGCGTGGGT TTCCCGGTGT TTTTGCTGTG TTTTTTCTCC CGTCCTTTTC GTGCGGGCGG CGGTTTGCGC
GCGGTGCCGG CTTGCGGCTT TATTTAGCTG TAGGCAAGCA AAGGGGGGGG CAGCGTCACG GACGGCTGCG TGCGGCGCGG
CAAGCAGCAG CACAGCAGAT GCAACGCGGG GTCGTCAGCT GTTTAGGTAG TTCGTTCTCT CTCCTTTTCT AACTTTTACT
CACTCACGTC CAAAAAAAAC AATCGATGTG AATGCGATTT CAGTTTGGTT GT

Locus: Os09g0469400

Loading...

Locus: Os09g0469400

Loading...