Os09t0474000-01

Locus

Os09g0474000

Description

bZIP transcription factor, Cold tolerance, Mediation of host susceptibility to disease

RAP-DB Gene Symbol Synonym(s)

OsbZIP73, bZIP73, OsTFX1

RAP-DB Gene Name Synonym(s)

bZIP transcription factor 73

CGSNL Gene Symbol

TFX1

CGSNL Gene Name

BZIP TRANSCRIPTION FACTOR TFX1

Oryzabase Gene Symbol Synonym(s)

OsbZIP73, bZIP73, OsTFX1

Oryzabase Gene Name Synonym(s)

b-ZIP transcription factor 73, bZIP transcription factor OsTFX1

Transcript Evidence

AK108319

Protein Evidence

Q69JJ9

Literature

PMID: 30120236

PMID: 17563377

Note

Manual Curation

August 20, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

Basic-leucine zipper domain (IPR004827)

Experimentally confirmed subcellular location

nucleus

Full-length cDNA

002-141-G12 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0474000-01)

RiceXPro (AK108319)

Others

Oryzabase (10153)

KEGG (Os09t0474000-01)

Transcript

837 bp

>Os09t0474000-01 bZIP transcription factor, Cold tolerance, Mediation of host susceptibility to disease
CGCTCAGAGAGAGCAAATTCTTCAGTAAGCAGAATCAAAGCAGATTAACCCTCATCTACT
TCTGGCCCTCTAAGAGTTCTCCACTAAGCAAGCGAAAACAGCCATGCTGCACCACCATTA
CCATGGCGAGGTGGCCAGCCTGCACTGCCTCTCACCTCCAAGCCTACCATTCAGTTCCCA
CTACCACAGCAACATGATCACCATGGCACCCTCGCCCTTCCACTTCCCAGCAGCTACCTG
TGAACCTATCCAGGAATTGCTCCCTGTGGTAGCGGGCAATCGCCCAGCCGGCTCTGGCAG
CACAGATGACGCCTACCAGATGGCAGCGGAGGAGGAGCGGAGGCGGCGGAGGATGATCTC
CAACCGGGAGTCGGCACGGCGGTCGCGCATGCGCAAGCAGCGGCAGCTCAGCGAGCTGAG
GGGGCAGGTTGTCCACCTCCGTGACGCCAACCGCCGCCTCCTTGATGAGCTCAACCAAGC
AATGAGGGGCTGCAGTGATGTCCACTGCGAGAACGCCCGGCTCAGGAAGGAGAGGGCCGA
GCTCCAGACCAAGCTCGAGCACCTCATGCAAGCACAGAAGAATAACACCTCGCCGAGCTC
CTCACAGCCATGCGAGAATATTTGATTACTGAATAATAAATCATTCTTAATTATCTCCTC
ATTTTAACTACGAGGATTATTATTAGTATATCAAAATAAGACATGTTTTGAGATGCTTCC
TTCGGCTTCTGTTTTTTTGTTTTATCTTTTATGTACGGGAATATTCTAACTGCCCATTAT
TGACATCTTTTTGTCAAGGTGGCTAAGATAAATATGGATTGAGCCTATTGGCGAGTT

CDS

522 bp

>Os09t0474000-01 bZIP transcription factor, Cold tolerance, Mediation of host susceptibility to disease
ATGCTGCACCACCATTACCATGGCGAGGTGGCCAGCCTGCACTGCCTCTCACCTCCAAGC
CTACCATTCAGTTCCCACTACCACAGCAACATGATCACCATGGCACCCTCGCCCTTCCAC
TTCCCAGCAGCTACCTGTGAACCTATCCAGGAATTGCTCCCTGTGGTAGCGGGCAATCGC
CCAGCCGGCTCTGGCAGCACAGATGACGCCTACCAGATGGCAGCGGAGGAGGAGCGGAGG
CGGCGGAGGATGATCTCCAACCGGGAGTCGGCACGGCGGTCGCGCATGCGCAAGCAGCGG
CAGCTCAGCGAGCTGAGGGGGCAGGTTGTCCACCTCCGTGACGCCAACCGCCGCCTCCTT
GATGAGCTCAACCAAGCAATGAGGGGCTGCAGTGATGTCCACTGCGAGAACGCCCGGCTC
AGGAAGGAGAGGGCCGAGCTCCAGACCAAGCTCGAGCACCTCATGCAAGCACAGAAGAAT
AACACCTCGCCGAGCTCCTCACAGCCATGCGAGAATATTTGA

Protein

174 aa

>Os09t0474000-01 bZIP transcription factor, Cold tolerance, Mediation of host susceptibility to disease
MLHHHYHGEVASLHCLSPPSLPFSSHYHSNMITMAPSPFHFPAATCEPIQELLPVVAGNR
PAGSGSTDDAYQMAAEEERRRRRMISNRESARRSRMRKQRQLSELRGQVVHLRDANRRLL
DELNQAMRGCSDVHCENARLRKERAELQTKLEHLMQAQKNNTSPSSSQPCENI*

5'UTR

chr09:18123361..18123463 (- strand) : 103 bp

CDS

chr09:18122839..18123360 (- strand) : 522 bp

3'UTR

chr09:18122627..18122838 (- strand) : 212 bp

FASTA

>Os09t0474000-01 class=Sequence position=chr09:18122627..18123463 (- strand)
CGCTCAGAGA GAGCAAATTC TTCAGTAAGC AGAATCAAAG CAGATTAACC CTCATCTACT TCTGGCCCTC TAAGAGTTCT
CCACTAAGCA AGCGAAAACA GCCATGCTGC ACCACCATTA CCATGGCGAG GTGGCCAGCC TGCACTGCCT CTCACCTCCA
AGCCTACCAT TCAGTTCCCA CTACCACAGC AACATGATCA CCATGGCACC CTCGCCCTTC CACTTCCCAG CAGCTACCTG
TGAACCTATC CAGGAATTGC TCCCTGTGGT AGCGGGCAAT CGCCCAGCCG GCTCTGGCAG CACAGATGAC GCCTACCAGA
TGGCAGCGGA GGAGGAGCGG AGGCGGCGGA GGATGATCTC CAACCGGGAG TCGGCACGGC GGTCGCGCAT GCGCAAGCAG
CGGCAGCTCA GCGAGCTGAG GGGGCAGGTT GTCCACCTCC GTGACGCCAA CCGCCGCCTC CTTGATGAGC TCAACCAAGC
AATGAGGGGC TGCAGTGATG TCCACTGCGA GAACGCCCGG CTCAGGAAGG AGAGGGCCGA GCTCCAGACC AAGCTCGAGC
ACCTCATGCA AGCACAGAAG AATAACACCT CGCCGAGCTC CTCACAGCCA TGCGAGAATA TTTGATTACT GAATAATAAA
TCATTCTTAA TTATCTCCTC ATTTTAACTA CGAGGATTAT TATTAGTATA TCAAAATAAG ACATGTTTTG AGATGCTTCC
TTCGGCTTCT GTTTTTTTGT TTTATCTTTT ATGTACGGGA ATATTCTAAC TGCCCATTAT TGACATCTTT TTGTCAAGGT
GGCTAAGATA AATATGGATT GAGCCTATTG GCGAGTT