Os09t0480700-01

Locus

Os09g0480700

Description

Similar to Transcription factor Hap5a-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5E

CGSNL Gene Name

HAP5E SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5E, NF-YC, CBF-C, OsNF-YC7, Os-NF-YC7, NF-YC7, NFYC7

Oryzabase Gene Name Synonym(s)

Nuclear factor Y C7 subunit, Nuclear factor Y C subunit 7, NUCLEAR FACTOR-Y subunit C7, NUCLEAR FACTOR-Y subunit NF-YC7, NF-YC subunit 7, NF-YC family 7

Transcript Evidence

AK105156 (DDBJ, Best hit)

Protein Evidence

B6SII8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

001-103-G06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0480700-01)

RiceXPro (AK105156)

Others

Oryzabase (8495)

KEGG (Os09t0480700-01)

Transcript

921 bp

>Os09t0480700-01 Similar to Transcription factor Hap5a-like protein.
AAGTGAAGAGAAGCAGCAAAGAGAGAGCTTTTCCATCCCCAAATCCCCTCCTCCTCCTCA
AACCCTAGCTAAGCTCCGCTCGCAGCAGCAGCTGCAGATGTTCTGGGCGGAGCAGTACCG
CGAGATCGAGGCCACCACCGACTTCAAGAACCACAACCTCCCCCTGGCCCGCATCAAGAA
GATCATGAAGGCCGACGAGGACGTCCGCATGATCGCCGCCGAGGCCCCCGTCGTGTTCGC
CCGCGCCTGCGAGATGTTCATCCTCGAGCTCACCCACCGCGGCTGGGCGCACGCCGAGGA
GAACAAGCGCCGTACGCTGCAGAAGTCCGACATTGCCGCCGCCATCGCGCGCACCGAGGT
GTTCGACTTCCTCGTCGACATCGTGCCCCGCGACGACGCCAAGGACGCCGACGCCGCCGC
GGCCGCGGCGGCGGCCGGCATCCCCCGCCCCGCCGCCGGTGTGCCGGCCACCGATCCGCT
CGCCTACTACTATGTGCCCCAGCAGTAATGTATCTGATTAACCCCTTTCAAGCCTTTTCT
AAGCGAAGGATGTGTTGTTGTTTGTTGTTGCTGTTGCTGTTCTTGTTGTTGTTGTTGCCG
CGTAATAAGATATGTTGATAATTTATGGCTTCCCCTGAGCTTAAAGAATTTGAGCTTTTG
GTTCTAGAATCTGGGTAAAATTGTTGTAATGGGGAAGACTGTATGACTGTATTTGTAGTG
CATGTCTTAACTTGTCGGATAGTGTAATCCGATAATTATTATGCGGTTAGCTGGTTACCT
CTCATGATTACTGTGCTCATGTGCTGTGCAATTTATGTTCTTTGTTTTGGATGTACAATG
CTGTAACCAGAATTTGGTTGTGTAAGGAAACTATTAAAGGTTGTGCGAGGGCAGTGTGGC
TATCGCTGCATTTTAGCTTAC

CDS

507 bp

>Os09t0480700-01 Similar to Transcription factor Hap5a-like protein.
AGTGAAGAGAAGCAGCAAAGAGAGAGCTTTTCCATCCCCAAATCCCCTCCTCCTCCTCAA
ACCCTAGCTAAGCTCCGCTCGCAGCAGCAGCTGCAGATGTTCTGGGCGGAGCAGTACCGC
GAGATCGAGGCCACCACCGACTTCAAGAACCACAACCTCCCCCTGGCCCGCATCAAGAAG
ATCATGAAGGCCGACGAGGACGTCCGCATGATCGCCGCCGAGGCCCCCGTCGTGTTCGCC
CGCGCCTGCGAGATGTTCATCCTCGAGCTCACCCACCGCGGCTGGGCGCACGCCGAGGAG
AACAAGCGCCGTACGCTGCAGAAGTCCGACATTGCCGCCGCCATCGCGCGCACCGAGGTG
TTCGACTTCCTCGTCGACATCGTGCCCCGCGACGACGCCAAGGACGCCGACGCCGCCGCG
GCCGCGGCGGCGGCCGGCATCCCCCGCCCCGCCGCCGGTGTGCCGGCCACCGATCCGCTC
GCCTACTACTATGTGCCCCAGCAGTAA

Protein

169 aa

>Os09t0480700-01 Similar to Transcription factor Hap5a-like protein.
SEEKQQRESFSIPKSPPPPQTLAKLRSQQQLQMFWAEQYREIEATTDFKNHNLPLARIKK
IMKADEDVRMIAAEAPVVFARACEMFILELTHRGWAHAEENKRRTLQKSDIAAAIARTEV
FDFLVDIVPRDDAKDADAAAAAAAAGIPRPAAGVPATDPLAYYYVPQQ*

5'UTR

chr09:18451612..18451612 (+ strand) : 1 bp

CDS

chr09:18451613..18451691 (+ strand) : 79 bp

chr09:18451868..18452295 (+ strand) : 428 bp

3'UTR

chr09:18452296..18452708 (+ strand) : 413 bp

FASTA

>Os09t0480700-01 class=Sequence position=chr09:18451612..18452708 (+ strand)
AAGTGAAGAG AAGCAGCAAA GAGAGAGCTT TTCCATCCCC AAATCCCCTC CTCCTCCTCA AACCCTAGCT AAGCTCCGCT
CGCAGCAGCC ATGGATCCCA CCAAATCCAG CACGCCGCCG CCGGTGATGG GCGCGCCCGT CGGCTTCCCG CCTGGCGCGT
ACCCTCCGCC TCCCCCCGCC GGCGCCGCCG CCGCCGCCTA CGCGCAGCAG CTCTACGCGC CCCCCGCCGC CGCGGCGGCG
CAGCAGGCGG CGGCGGCGCA GCAGCAGCTG CAGATGTTCT GGGCGGAGCA GTACCGCGAG ATCGAGGCCA CCACCGACTT
CAAGAACCAC AACCTCCCCC TGGCCCGCAT CAAGAAGATC ATGAAGGCCG ACGAGGACGT CCGCATGATC GCCGCCGAGG
CCCCCGTCGT GTTCGCCCGC GCCTGCGAGA TGTTCATCCT CGAGCTCACC CACCGCGGCT GGGCGCACGC CGAGGAGAAC
AAGCGCCGTA CGCTGCAGAA GTCCGACATT GCCGCCGCCA TCGCGCGCAC CGAGGTGTTC GACTTCCTCG TCGACATCGT
GCCCCGCGAC GACGCCAAGG ACGCCGACGC CGCCGCGGCC GCGGCGGCGG CCGGCATCCC CCGCCCCGCC GCCGGTGTGC
CGGCCACCGA TCCGCTCGCC TACTACTATG TGCCCCAGCA GTAATGTATC TGATTAACCC CTTTCAAGCC TTTTCTAAGC
GAAGGATGTG TTGTTGTTTG TTGTTGCTGT TGCTGTTCTT GTTGTTGTTG TTGCCGCGTA ATAAGATATG TTGATAATTT
ATGGCTTCCC CTGAGCTTAA AGAATTTGAG CTTTTGGTTC TAGAATCTGG GTAAAATTGT TGTAATGGGG AAGACTGTAT
GACTGTATTT GTAGTGCATG TCTTAACTTG TCGGATAGTG TAATCCGATA ATTATTATGC GGTTAGCTGG TTACCTCTCA
TGATTACTGT GCTCATGTGC TGTGCAATTT ATGTTCTTTG TTTTGGATGT ACAATGCTGT AACCAGAATT TGGTTGTGTA
AGGAAACTAT TAAAGGTTGT GCGAGGGCAG TGTGGCTATC GCTGCATTTT AGCTTAC

Locus: Os09g0480700

Loading...

Locus: Os09g0480700

Loading...