Os09t0481700-01

Locus

Os09g0481700

Description

SUSIBA2-like (WRKY transcription factor 80).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY90

CGSNL Gene Name

WRKY GENE 90

Oryzabase Gene Symbol Synonym(s)

OsWRKY90

Oryzabase Gene Name Synonym(s)

Rice WRKY gene90

Transcript Evidence

AK065078 (DDBJ, Best hit)

Protein Evidence

Q8H6W1 (UniProt)

Literature

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

DNA-binding WRKY (IPR003657)

Full-length cDNA

J013001K23 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0481700-01)

RiceXPro (AK065078)

Others

Oryzabase (6596)

KEGG (Os09t0481700-01)

Transcript

2762 bp

>Os09t0481700-01 SUSIBA2-like (WRKY transcription factor 80).
AGTCTTCTCTTCACCTTCTTCTCATCCTCTTCTTCTCCTCCTCGGTCAAACCGCCTTTTC
TTCTCTCCCCTATCCTCCGCTCCGAGGGAGAAAAAAAACAAAGAAAGAAAGAAAGAAAGA
AAAAGAGTACTAGTAGCACCCGGAGAGTGGAGGAAAGGGAGTAGGCGGAGCCAAATCTCG
TTTCTCTTTAGTTGTTGTTAGTACCCTTAGTGGAAGAATCTCTCCCCTTTTCTTGTGTTT
CTTGGGTTTTGAAGTTTTTTGTTGTTGGGAGGTATGAGGAATGAAGGCCTAACCTGAGGC
AAGATCTTCGTTTTCCTTCATTTGTGGGGGTGTTTGTTGGTGGAAACGGATCAAGAAAAG
CCGGAATTTCGGTTCTGAAATCGTCGGTTTTGATATCGGTTTCTCTCTGTTGATTGGAGA
GAGAGGGAGAGAGCAAACGCATGATCTGTGTCTGATTCTGACGGGCCTTGTCGCGGTCCG
TATCAGTTCATCCATCCCAACTTGCTGTTCGTTTTGTGTGGTGGTGTTTCGCTTTTTTGG
GAAGAGAGGAGAGGAAGCAATCATTCGGCGGCGACGGCCCCGCCCACTTGAGTTAAACTT
GATTGCTCTGTCGCATGGCCAGCAGTAGCGACCATGGATCCCTCATGGAGGACTGGATGC
CACCACCCACACCCAGCCCGAGAACACTCATGTCAAGCTTCTTGAATGAAGATTTTGTCT
CTGGTTCATTTTCCAATATTTTCAGTGATCATGAGAGCAACAAACCCCAGGATCAGTTTG
AGAGAAACAGAGAGCTTGTGGATTTGAGTAAGGAAGTGCCTTCCCAATTCGCAAGACCCG
CATTCCAGAGGGATGCTTCCCTGGATCATAGCTTGGTCAGTCCTACACAGAGATCAAACT
CGCATGGTGGTTTGGCAGAGCGCAGGGCTGCGAGGGCTGGTTTCAGTGTCCCGAAAATCG
ATACATCCCGTGGTGGTTCATCCACAGTAATTCGATCGCCCGTGGCAATTCCACCAGGTC
TTAGTCCAACAACACTTCTCGAGTCACCGGTTTTCCTTTACAACGCAATGGCACAGCCTT
CTCCAACCACTGGCACACTGCCATTTTTGATGGCTTCAAATGCTAAGTCAACAATACCGT
CAGCTACCAAGATGGACGAAGATTGCACATTTGGCAATGACACTTTCTCCTTCCAACCGC
ATGTAGGGTCGAGACGGCCAAATTTCTCCGCTGCAGAAAAGGGTCCCAATGCTTGTCACC
AAAACCAATCGCTGTCGAATATCCATCAGCGGGAATCCAGTCTTCAGTCAAGCTTTACTG
CAGTCAAAGATATCACTGATGAAAAAAACATTAAAACAAAGACATCTGACTCCATGTTTG
GTGATAACCACTCTTCTGATGAACAAGATGATGAGACTAACCAAAATGGAGAAAACTCTA
TGCCACCTCCGAACCACCGTTCAGGTGTCCCTCTGTCACATACCAATGATCCAGAAGTGA
ATGTCCTAGAGAACCGCGGTTCACAGACATGCCATAACTCTGCATCCTTGTGGGACAATG
CCAAAAATGATTGCCTTCAAGATGTTCAAAGTGAAGTTATTGAAACAAGAACAGCTGCTT
GTCTTCCAGTATCAACCAATTGTGATACATCTATCATGGAGTCCCAAGATGCAGTTGATG
TGTCGTCAACACTATCTAATGAGGAGGATGATAGGGCAACGCATGGCACGGCTTCTATAG
AGTGCAACGGGGATGGAGATGAGACTGATTCCAAGAGAAGGAAGCTGGATGCTTTGACAG
CTGCAACTGCTGCTATTACCACCACCAGTAACATTGACATGGGAGCTGCGGCATCGAGAG
GTGTCCGGGAGCCTCGTGTTGTTGTTCAGACAACAAGTGAGGTTGACATCCTTGATGACG
GTTACCGCTGGCGCAAGTATGGACAGAAGGTTGTTAAAGGAAATCCAAACCCAAGGAGCT
ATTACAAATGTACGCACCAAGGGTGTTCGGTGCGCAAGCACGTGGAGAGAGCATCGCATG
ATCTAAAATCCGTCATCACGACGTACGAGGGGAAGCACAACCATGAAGTTCCAGCTGCCA
GAAATAGTGGACATGGGAGCTCTGGATCTGGAAACGCTCCATCTGCACCGCAATCTAACG
GCTCTCAGCGCAGGCAAGAACAAGGGCAAGCCAGCTTCAGCCAGTTTGGTGGCGCGGCTC
CCTTCAGCTCCTTCGTTCTCCCACCAAGAAACCAATTTGGACCATCGGCGAGCAATTTCC
CCTTTGGGATGGTCCCGCCAGGCATGGCGATTCCCATGCCATCTCTAGGGTCTCTTGCTC
CAGCAAAGATGGCTGGTCATCCATCCACCATGCAGGGCTACCAGGGGCTCATGATTCCGG
AAGGAGAGATGAAGACAGAGCCCATGTCGCAGCTCGGCTTCCCCGCGGTAAACCAATCTT
CATCATCCTTCCAACAGATGATGAACAGGCCTCCATCATTTGGACCTCAGATGTAAATAA
TAATATTAAAGAAAGAAAAGAAAATGATAGATGTGCTTCAGCTTCTATACATGGTAGCAA
TGCTACAACATAGCTTTGTTGTTCTAGCTTTTACCTGTTATTTTTTCTTTGGGCTTTTAT
TTTTTGGAAGCAAAGAATGCAGAAGATGTTACCCGTTTTGTTTATGTTGTAATTGGAAAA
AAAAGGTGGTGGTAGTGTTCAGGACAAAAGGCAAAATCATTCAATTGGAAGTGCTGATGG
TG

CDS

1902 bp

>Os09t0481700-01 SUSIBA2-like (WRKY transcription factor 80).
ATGGCCAGCAGTAGCGACCATGGATCCCTCATGGAGGACTGGATGCCACCACCCACACCC
AGCCCGAGAACACTCATGTCAAGCTTCTTGAATGAAGATTTTGTCTCTGGTTCATTTTCC
AATATTTTCAGTGATCATGAGAGCAACAAACCCCAGGATCAGTTTGAGAGAAACAGAGAG
CTTGTGGATTTGAGTAAGGAAGTGCCTTCCCAATTCGCAAGACCCGCATTCCAGAGGGAT
GCTTCCCTGGATCATAGCTTGGTCAGTCCTACACAGAGATCAAACTCGCATGGTGGTTTG
GCAGAGCGCAGGGCTGCGAGGGCTGGTTTCAGTGTCCCGAAAATCGATACATCCCGTGGT
GGTTCATCCACAGTAATTCGATCGCCCGTGGCAATTCCACCAGGTCTTAGTCCAACAACA
CTTCTCGAGTCACCGGTTTTCCTTTACAACGCAATGGCACAGCCTTCTCCAACCACTGGC
ACACTGCCATTTTTGATGGCTTCAAATGCTAAGTCAACAATACCGTCAGCTACCAAGATG
GACGAAGATTGCACATTTGGCAATGACACTTTCTCCTTCCAACCGCATGTAGGGTCGAGA
CGGCCAAATTTCTCCGCTGCAGAAAAGGGTCCCAATGCTTGTCACCAAAACCAATCGCTG
TCGAATATCCATCAGCGGGAATCCAGTCTTCAGTCAAGCTTTACTGCAGTCAAAGATATC
ACTGATGAAAAAAACATTAAAACAAAGACATCTGACTCCATGTTTGGTGATAACCACTCT
TCTGATGAACAAGATGATGAGACTAACCAAAATGGAGAAAACTCTATGCCACCTCCGAAC
CACCGTTCAGGTGTCCCTCTGTCACATACCAATGATCCAGAAGTGAATGTCCTAGAGAAC
CGCGGTTCACAGACATGCCATAACTCTGCATCCTTGTGGGACAATGCCAAAAATGATTGC
CTTCAAGATGTTCAAAGTGAAGTTATTGAAACAAGAACAGCTGCTTGTCTTCCAGTATCA
ACCAATTGTGATACATCTATCATGGAGTCCCAAGATGCAGTTGATGTGTCGTCAACACTA
TCTAATGAGGAGGATGATAGGGCAACGCATGGCACGGCTTCTATAGAGTGCAACGGGGAT
GGAGATGAGACTGATTCCAAGAGAAGGAAGCTGGATGCTTTGACAGCTGCAACTGCTGCT
ATTACCACCACCAGTAACATTGACATGGGAGCTGCGGCATCGAGAGGTGTCCGGGAGCCT
CGTGTTGTTGTTCAGACAACAAGTGAGGTTGACATCCTTGATGACGGTTACCGCTGGCGC
AAGTATGGACAGAAGGTTGTTAAAGGAAATCCAAACCCAAGGAGCTATTACAAATGTACG
CACCAAGGGTGTTCGGTGCGCAAGCACGTGGAGAGAGCATCGCATGATCTAAAATCCGTC
ATCACGACGTACGAGGGGAAGCACAACCATGAAGTTCCAGCTGCCAGAAATAGTGGACAT
GGGAGCTCTGGATCTGGAAACGCTCCATCTGCACCGCAATCTAACGGCTCTCAGCGCAGG
CAAGAACAAGGGCAAGCCAGCTTCAGCCAGTTTGGTGGCGCGGCTCCCTTCAGCTCCTTC
GTTCTCCCACCAAGAAACCAATTTGGACCATCGGCGAGCAATTTCCCCTTTGGGATGGTC
CCGCCAGGCATGGCGATTCCCATGCCATCTCTAGGGTCTCTTGCTCCAGCAAAGATGGCT
GGTCATCCATCCACCATGCAGGGCTACCAGGGGCTCATGATTCCGGAAGGAGAGATGAAG
ACAGAGCCCATGTCGCAGCTCGGCTTCCCCGCGGTAAACCAATCTTCATCATCCTTCCAA
CAGATGATGAACAGGCCTCCATCATTTGGACCTCAGATGTAA

Protein

634 aa

>Os09t0481700-01 SUSIBA2-like (WRKY transcription factor 80).
MASSSDHGSLMEDWMPPPTPSPRTLMSSFLNEDFVSGSFSNIFSDHESNKPQDQFERNRE
LVDLSKEVPSQFARPAFQRDASLDHSLVSPTQRSNSHGGLAERRAARAGFSVPKIDTSRG
GSSTVIRSPVAIPPGLSPTTLLESPVFLYNAMAQPSPTTGTLPFLMASNAKSTIPSATKM
DEDCTFGNDTFSFQPHVGSRRPNFSAAEKGPNACHQNQSLSNIHQRESSLQSSFTAVKDI
TDEKNIKTKTSDSMFGDNHSSDEQDDETNQNGENSMPPPNHRSGVPLSHTNDPEVNVLEN
RGSQTCHNSASLWDNAKNDCLQDVQSEVIETRTAACLPVSTNCDTSIMESQDAVDVSSTL
SNEEDDRATHGTASIECNGDGDETDSKRRKLDALTAATAAITTTSNIDMGAAASRGVREP
RVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSV
ITTYEGKHNHEVPAARNSGHGSSGSGNAPSAPQSNGSQRRQEQGQASFSQFGGAAPFSSF
VLPPRNQFGPSASNFPFGMVPPGMAIPMPSLGSLAPAKMAGHPSTMQGYQGLMIPEGEMK
TEPMSQLGFPAVNQSSSSFQQMMNRPPSFGPQM*

5'UTR

chr09:18500627..18501218 (- strand) : 592 bp

chr09:18499901..18499922 (- strand) : 22 bp

CDS

chr09:18499445..18499900 (- strand) : 456 bp

chr09:18498856..18499026 (- strand) : 171 bp

chr09:18498158..18498696 (- strand) : 539 bp

chr09:18497883..18498077 (- strand) : 195 bp

chr09:18497222..18497762 (- strand) : 541 bp

3'UTR

chr09:18496976..18497221 (- strand) : 246 bp

FASTA

>Os09t0481700-01 class=Sequence position=chr09:18496976..18501218 (- strand)
AGTCTTCTCT TCACCTTCTT CTCATCCTCT TCTTCTCCTC CTCGGTCAAA CCGCCTTTTC TTCTCTCCCC TATCCTCCGC
TCCGAGGGAG AAAAAAAACA AAGAAAGAAA GAAAGAAAGA AAAAGAGTAC TAGTAGCACC CGGAGAGTGG AGGAAAGGGA
GTAGGCGGAG CCAAATCTCG TTTCTCTTTA GTTGTTGTTA GTACCCTTAG TGGAAGAATC TCTCCCCTTT TCTTGTGTTT
CTTGGGTTTT GAAGTTTTTT GTTGTTGGGA GGTATGAGGA ATGAAGGCCT AACCTGAGGC AAGATCTTCG TTTTCCTTCA
TTTGTGGGGG TGTTTGTTGG TGGAAACGGA TCAAGAAAAG CCGGAATTTC GGTTCTGAAA TCGTCGGTTT TGATATCGGT
TTCTCTCTGT TGATTGGAGA GAGAGGGAGA GAGCAAACGC ATGATCTGTG TCTGATTCTG ACGGGCCTTG TCGCGGTCCG
TATCAGTTCA TCCATCCCAA CTTGCTGTTC GTTTTGTGTG GTGGTGTTTC GCTTTTTTGG GAAGAGAGGA GAGGAAGCAA
TCATTCGGCG GCGACGGCCC CGCCCACTTG AGGTACCAGT TGGAAATTTC CCCCCTTTTC TTTGTGCTTT TGTTTTTGCT
GGTTTGTGCT TATCTCTTAC TACTTGAGGT ACATCTTTTT GACCAGGTTT TTTTTTGTGG TAACGGCGAT TTTTGGGGAT
AAAGTTTGCA TCTTAGGTCG GGATTTTTTC TTGTTTCAGT GGTGGAATGT CTCCATTTTG AGCGAAATTG CGTCTTTTGT
GGGTTCATGT TTGGGGATTT GGGGGAAATC GTGCGGCCTG GTTTGCTGTG GTGGGGAATT TTTTTCTTGT TTCAGTTGAT
TGGTTTCTCC ATTTCATATC AAACCGTGTC TTTTGAGTTT CTCGTGCATA TATGGAGAGG ATATCCATGG TTATCTAGAA
AAAAAATGCA AAGTTTTCAA CTTGCTCTGT AATGGACTCT TCCAACGTTT TGCATTCATT TCTTGAGCTC CTCACCTTGG
TTTTCTTCAT TATTGTGTTC AAACCTACTC TGATCTTGGT TCTGAACTTC TGATGTTTGT CTGGTTACTG GTCATGTAGG
ATTGATGGCT TTGTGGTCTG GTCTCTTGCT AACTTCTTGT GCTTCTGTGA TTCTGATAAG CTTTTCTTCG TGTTTTGTGT
AGAGATAACA GTTTTTTTCT CTTATCAATT ATGCTATGAG ATATTCCATG TTTAATCAGG ACTAACTAAT GCTGTATTAC
CTGATACTCG TTTCAGTTAA ACTTGATTGC TCTGTCGCAT GGCCAGCAGT AGCGACCATG GATCCCTCAT GGAGGACTGG
ATGCCACCAC CCACACCCAG CCCGAGAACA CTCATGTCAA GCTTCTTGAA TGAAGATTTT GTCTCTGGTT CATTTTCCAA
TATTTTCAGT GATCATGAGA GCAACAAACC CCAGGATCAG TTTGAGAGAA ACAGAGAGCT TGTGGATTTG AGTAAGGAAG
TGCCTTCCCA ATTCGCAAGA CCCGCATTCC AGAGGGATGC TTCCCTGGAT CATAGCTTGG TCAGTCCTAC ACAGAGATCA
AACTCGCATG GTGGTTTGGC AGAGCGCAGG GCTGCGAGGG CTGGTTTCAG TGTCCCGAAA ATCGATACAT CCCGTGGTGG
TTCATCCACA GTAATTCGAT CGCCCGTGGC AATTCCACCA GGTCTTAGTC CAACAACACT TCTCGAGTCA CCGGTTTTCC
TTTACAACGC AATGGTATGT CATGTTTCCA CAATTTGTTT GTTTATGCAT TATGCCCCGA TAGGATGTCT CTAGCAAGGT
TGTGATAAGC CATAGTTAGA GTTACTGAGT TAGTATCAAA GACTTGCAGG TTGCAATTAC CAGGCATATG AGTTTTTCTT
ATTTATTTAT TAACGAACAG ACCATGGGGT TTGGCAGTAA AGAGGACATT GATTGATGTA TATTATGTAG AACATGATTG
TGGGCAGTAT CAAAGCTTGT AAATACAGTA AGTACTGAAT GATGCTTACT GTTAGGAACA CTACTAGAAA TGATTTTATG
ACATCTTACA ATTTTAGACA TTTGTCTTGT GATTTATTAT GCATAAGTTA TTTTTTAATT CATAACTTAA CAAATATGTT
TGTGCACTTC TGTTGCGATA TTTGCTATAC AGGCACAGCC TTCTCCAACC ACTGGCACAC TGCCATTTTT GATGGCTTCA
AATGCTAAGT CAACAATACC GTCAGCTACC AAGATGGACG AAGATTGCAC ATTTGGCAAT GACACTTTCT CCTTCCAACC
GCATGTAGGG TCGAGACGGC CAAATTTCTC CGCTGCAGAA AAGGTGATTC TTTGACTGTC GGTCTCCATT TCAGTTTTCC
TTCCAGTATT ATGTAATATT CCTTCCAGTA TTATGTAATA TTGTCTCTGT TCTTTTATTG CAAACTTCAC CGCCAAAATG
ACCCACCTCA TTCCTTTTAA TCCTTTTGTG TTTATTGTAC AGGGTCCCAA TGCTTGTCAC CAAAACCAAT CGCTGTCGAA
TATCCATCAG CGGGAATCCA GTCTTCAGTC AAGCTTTACT GCAGTCAAAG ATATCACTGA TGAAAAAAAC ATTAAAACAA
AGACATCTGA CTCCATGTTT GGTGATAACC ACTCTTCTGA TGAACAAGAT GATGAGACTA ACCAAAATGG AGAAAACTCT
ATGCCACCTC CGAACCACCG TTCAGGTGTC CCTCTGTCAC ATACCAATGA TCCAGAAGTG AATGTCCTAG AGAACCGCGG
TTCACAGACA TGCCATAACT CTGCATCCTT GTGGGACAAT GCCAAAAATG ATTGCCTTCA AGATGTTCAA AGTGAAGTTA
TTGAAACAAG AACAGCTGCT TGTCTTCCAG TATCAACCAA TTGTGATACA TCTATCATGG AGTCCCAAGA TGCAGTTGAT
GTGTCGTCAA CACTATCTAA TGAGGAGGAT GATAGGGCAA CGCATGGCAC GGCTTCTATA GAGTGCAACG GGGATGGAGA
TGAGACTGAT TCCAAGAGAA GGTTAATGCC ATCTACCACT TAATTACTTA ATGTAGGCAT GAATGCATGA TAATTCACTG
ATGGATCTGG TTCTTTTTCA GGAAGCTGGA TGCTTTGACA GCTGCAACTG CTGCTATTAC CACCACCAGT AACATTGACA
TGGGAGCTGC GGCATCGAGA GGTGTCCGGG AGCCTCGTGT TGTTGTTCAG ACAACAAGTG AGGTTGACAT CCTTGATGAC
GGTTACCGCT GGCGCAAGTA TGGACAGAAG GTTGTTAAAG GAAATCCAAA CCCAAGGTCA GTTTAGTGTC ACTGCATTTC
TTGCAGTAAT TGATCATGCG GCATGCATCC TTTGATTAAT GTTTGATATT CTTGGTACCA TCCTGAGATG AGTAACATTA
TTTCATTTGT CTGCAGGAGC TATTACAAAT GTACGCACCA AGGGTGTTCG GTGCGCAAGC ACGTGGAGAG AGCATCGCAT
GATCTAAAAT CCGTCATCAC GACGTACGAG GGGAAGCACA ACCATGAAGT TCCAGCTGCC AGAAATAGTG GACATGGGAG
CTCTGGATCT GGAAACGCTC CATCTGCACC GCAATCTAAC GGCTCTCAGC GCAGGCAAGA ACAAGGGCAA GCCAGCTTCA
GCCAGTTTGG TGGCGCGGCT CCCTTCAGCT CCTTCGTTCT CCCACCAAGA AACCAATTTG GACCATCGGC GAGCAATTTC
CCCTTTGGGA TGGTCCCGCC AGGCATGGCG ATTCCCATGC CATCTCTAGG GTCTCTTGCT CCAGCAAAGA TGGCTGGTCA
TCCATCCACC ATGCAGGGCT ACCAGGGGCT CATGATTCCG GAAGGAGAGA TGAAGACAGA GCCCATGTCG CAGCTCGGCT
TCCCCGCGGT AAACCAATCT TCATCATCCT TCCAACAGAT GATGAACAGG CCTCCATCAT TTGGACCTCA GATGTAAATA
ATAATATTAA AGAAAGAAAA GAAAATGATA GATGTGCTTC AGCTTCTATA CATGGTAGCA ATGCTACAAC ATAGCTTTGT
TGTTCTAGCT TTTACCTGTT ATTTTTTCTT TGGGCTTTTA TTTTTTGGAA GCAAAGAATG CAGAAGATGT TACCCGTTTT
GTTTATGTTG TAATTGGAAA AAAAAGGTGG TGGTAGTGTT CAGGACAAAA GGCAAAATCA TTCAATTGGA AGTGCTGATG
GTG