Os09t0481700-02

Locus

Os09g0481700

Description

SUSIBA2-like (WRKY transcription factor 80).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY90

CGSNL Gene Name

WRKY GENE 90

Oryzabase Gene Symbol Synonym(s)

OsWRKY90

Oryzabase Gene Name Synonym(s)

Rice WRKY gene90

Transcript Evidence

AK103745 (DDBJ, Best hit)

Protein Evidence

Q8H6W1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

DNA-binding WRKY (IPR003657)

Full-length cDNA

J033138N11 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0481700-02)

RiceXPro (AK103745)

Others

Oryzabase (6596)

KEGG (Os09t0481700-02)

Transcript

2172 bp

>Os09t0481700-02 SUSIBA2-like (WRKY transcription factor 80).
AGTTAAACTTGATTGCTCTGTCGCATGGCCAGCAGTAGCGACCATGGATCCCTCATGGAG
GACTGGATGCCACCACCCACACCCAGCCCGAGAACACTCATGTCAAGCTTCTTGAATGAA
GATTTTGTCTCTGGTTCATTTTCCAATATTTTCAGTGATCATGAGAGCAACAAACCCCAG
GATCAGTTTGAGAGAAACAGAGAGCTTGTGGATTTGAGTAAGGAAGTGCCTTCCCAATTC
GCAAGACCCGCATTCCAGAGGGATGCTTCCCTGGATCATAGCTTGGTCAGTCCTACACAG
AGATCAAACTCGCATGGTGGTTTGGCAGAGCGCAGGGCTGCGAGGGCTGGTTTCAGTGTC
CCGAAAATCGATACATCCCGTGGTGGTTCATCCACAGTAATTCGATCGCCCGTGGCAATT
CCACCAGGTCTTAGTCCAACAACACTTCTCGAGTCACCGGTTTTCCTTTACAACGCAATG
GCACAGCCTTCTCCAACCACTGGCACACTGCCATTTTTGATGGCTTCAAATGCTAAGTCA
ACAATACCGTCAGCTACCAAGATGGACGAAGATTGCACATTTGGCAATGACACTTTCTCC
TTCCAACCGCATGTAGGGTCGAGACGGCCAAATTTCTCCGCTGCAGAAAAGGGTCCCAAT
GCTTGTCACCAAAACCAATCGCTGTCGAATATCCATCAGCGGGAATCCAGTCTTCAGTCA
AGCTTTACTGCAGTCAAAGATATCACTGATGAAAAAAACATTAAAACAAAGACATCTGAC
TCCATGTTTGGTGATAACCACTCTTCTGATGAACAAGATGATGAGACTAACCAAAATGGA
GAAAACTCTATGCCACCTCCGAACCACCGTTCAGGTGTCCCTCTGTCACATACCAATGAT
CCAGAAGTGAATGTCCTAGAGAACCGCGGTTCACAGACATGCCATAACTCTGCATCCTTG
TGGGACAATGCCAAAAATGATTGCCTTCAAGATGTTCAAAGTGAAGTTATTGAAACAAGA
ACAGCTGCTTGTCTTCCAGTATCAACCAATTGTGATACATCTATCATGGAGTCCCAAGAT
GCAGTTGATGTGTCGTCAACACTATCTAATGAGGAGGATGATAGGGCAACGCATGGCACG
GCTTCTATAGAGTGCAACGGGGATGGAGATGAGACTGATTCCAAGAGAAGGAAGCTGGAT
GCTTTGACAGCTGCAACTGCTGCTATTACCACCACCAGTAACATTGACATGGGAGCTGCG
GCATCGAGAGGTGTCCGGGAGCCTCGTGTTGTTGTTCAGACAACAAGTGAGGTTGACATC
CTTGATGACGGTTACCGCTGGCGCAAGTATGGACAGAAGGTTGTTAAAGGAAATCCAAAC
CCAAGGAGCTATTACAAATGTACGCACCAAGGGTGTTCGGTGCGCAAGCACGTGGAGAGA
GCATCGCATGATCTAAAATCCGTCATCACGACGTACGAGGGGAAGCACAACCATGAAGTT
CCAGCTGCCAGAAATAGTGGACATGGGAGCTCTGGATCTGGAAACGCTCCATCTGCACCG
CAATCTAACGGCTCTCAGCGCAGGCAAGAACAAGGGCAAGCCAGCTTCAGCCAGTTTGGT
GGCGCGGCTCCCTTCAGCTCCTTCGTTCTCCCACCAAGAAACCAATTTGGACCATCGGCG
AGCAATTTCCCCTTTGGGATGGTCCCGCCAGGCATGGCGATTCCCATGCCATCTCTAGGG
TCTCTTGCTCCAGCAAAGATGGCTGGTCATCCATCCACCATGCAGGGCTACCAGGGGCTC
ATGATTCCGGAAGGAGAGATGAAGACAGAGCCCATGTCGCAGCTCGGCTTCCCCGCGGTA
AACCAATCTTCATCATCCTTCCAACAGATGATGAACAGGCCTCCATCATTTGGACCTCAG
ATGTAAATAATAATATTAAAGAAAGAAAAGAAAATGATAGATGTGCTTCAGCTTCTATAC
ATGGTAGCAATGCTACAACATAGCTTTGTTGTTCTAGCTTTTACCTGTTATTTTTTCTTT
GGGCTTTTATTTTTTGGAAGCAAAGAATGCAGAAGATGTTACCCGTTTTGTTTATGTTGT
AATTGGAAAAAAAAGGTGGTGGTAGTGTTCAGGACAAAAGGCAAAATCATTCAATTGGAA
GTGCTGATGGTG

CDS

1902 bp

>Os09t0481700-02 SUSIBA2-like (WRKY transcription factor 80).
ATGGCCAGCAGTAGCGACCATGGATCCCTCATGGAGGACTGGATGCCACCACCCACACCC
AGCCCGAGAACACTCATGTCAAGCTTCTTGAATGAAGATTTTGTCTCTGGTTCATTTTCC
AATATTTTCAGTGATCATGAGAGCAACAAACCCCAGGATCAGTTTGAGAGAAACAGAGAG
CTTGTGGATTTGAGTAAGGAAGTGCCTTCCCAATTCGCAAGACCCGCATTCCAGAGGGAT
GCTTCCCTGGATCATAGCTTGGTCAGTCCTACACAGAGATCAAACTCGCATGGTGGTTTG
GCAGAGCGCAGGGCTGCGAGGGCTGGTTTCAGTGTCCCGAAAATCGATACATCCCGTGGT
GGTTCATCCACAGTAATTCGATCGCCCGTGGCAATTCCACCAGGTCTTAGTCCAACAACA
CTTCTCGAGTCACCGGTTTTCCTTTACAACGCAATGGCACAGCCTTCTCCAACCACTGGC
ACACTGCCATTTTTGATGGCTTCAAATGCTAAGTCAACAATACCGTCAGCTACCAAGATG
GACGAAGATTGCACATTTGGCAATGACACTTTCTCCTTCCAACCGCATGTAGGGTCGAGA
CGGCCAAATTTCTCCGCTGCAGAAAAGGGTCCCAATGCTTGTCACCAAAACCAATCGCTG
TCGAATATCCATCAGCGGGAATCCAGTCTTCAGTCAAGCTTTACTGCAGTCAAAGATATC
ACTGATGAAAAAAACATTAAAACAAAGACATCTGACTCCATGTTTGGTGATAACCACTCT
TCTGATGAACAAGATGATGAGACTAACCAAAATGGAGAAAACTCTATGCCACCTCCGAAC
CACCGTTCAGGTGTCCCTCTGTCACATACCAATGATCCAGAAGTGAATGTCCTAGAGAAC
CGCGGTTCACAGACATGCCATAACTCTGCATCCTTGTGGGACAATGCCAAAAATGATTGC
CTTCAAGATGTTCAAAGTGAAGTTATTGAAACAAGAACAGCTGCTTGTCTTCCAGTATCA
ACCAATTGTGATACATCTATCATGGAGTCCCAAGATGCAGTTGATGTGTCGTCAACACTA
TCTAATGAGGAGGATGATAGGGCAACGCATGGCACGGCTTCTATAGAGTGCAACGGGGAT
GGAGATGAGACTGATTCCAAGAGAAGGAAGCTGGATGCTTTGACAGCTGCAACTGCTGCT
ATTACCACCACCAGTAACATTGACATGGGAGCTGCGGCATCGAGAGGTGTCCGGGAGCCT
CGTGTTGTTGTTCAGACAACAAGTGAGGTTGACATCCTTGATGACGGTTACCGCTGGCGC
AAGTATGGACAGAAGGTTGTTAAAGGAAATCCAAACCCAAGGAGCTATTACAAATGTACG
CACCAAGGGTGTTCGGTGCGCAAGCACGTGGAGAGAGCATCGCATGATCTAAAATCCGTC
ATCACGACGTACGAGGGGAAGCACAACCATGAAGTTCCAGCTGCCAGAAATAGTGGACAT
GGGAGCTCTGGATCTGGAAACGCTCCATCTGCACCGCAATCTAACGGCTCTCAGCGCAGG
CAAGAACAAGGGCAAGCCAGCTTCAGCCAGTTTGGTGGCGCGGCTCCCTTCAGCTCCTTC
GTTCTCCCACCAAGAAACCAATTTGGACCATCGGCGAGCAATTTCCCCTTTGGGATGGTC
CCGCCAGGCATGGCGATTCCCATGCCATCTCTAGGGTCTCTTGCTCCAGCAAAGATGGCT
GGTCATCCATCCACCATGCAGGGCTACCAGGGGCTCATGATTCCGGAAGGAGAGATGAAG
ACAGAGCCCATGTCGCAGCTCGGCTTCCCCGCGGTAAACCAATCTTCATCATCCTTCCAA
CAGATGATGAACAGGCCTCCATCATTTGGACCTCAGATGTAA

Protein

634 aa

>Os09t0481700-02 SUSIBA2-like (WRKY transcription factor 80).
MASSSDHGSLMEDWMPPPTPSPRTLMSSFLNEDFVSGSFSNIFSDHESNKPQDQFERNRE
LVDLSKEVPSQFARPAFQRDASLDHSLVSPTQRSNSHGGLAERRAARAGFSVPKIDTSRG
GSSTVIRSPVAIPPGLSPTTLLESPVFLYNAMAQPSPTTGTLPFLMASNAKSTIPSATKM
DEDCTFGNDTFSFQPHVGSRRPNFSAAEKGPNACHQNQSLSNIHQRESSLQSSFTAVKDI
TDEKNIKTKTSDSMFGDNHSSDEQDDETNQNGENSMPPPNHRSGVPLSHTNDPEVNVLEN
RGSQTCHNSASLWDNAKNDCLQDVQSEVIETRTAACLPVSTNCDTSIMESQDAVDVSSTL
SNEEDDRATHGTASIECNGDGDETDSKRRKLDALTAATAAITTTSNIDMGAAASRGVREP
RVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSV
ITTYEGKHNHEVPAARNSGHGSSGSGNAPSAPQSNGSQRRQEQGQASFSQFGGAAPFSSF
VLPPRNQFGPSASNFPFGMVPPGMAIPMPSLGSLAPAKMAGHPSTMQGYQGLMIPEGEMK
TEPMSQLGFPAVNQSSSSFQQMMNRPPSFGPQM*

5'UTR

chr09:18499901..18499924 (- strand) : 24 bp

CDS

chr09:18499445..18499900 (- strand) : 456 bp

chr09:18498856..18499026 (- strand) : 171 bp

chr09:18498158..18498696 (- strand) : 539 bp

chr09:18497883..18498077 (- strand) : 195 bp

chr09:18497222..18497762 (- strand) : 541 bp

3'UTR

chr09:18496976..18497221 (- strand) : 246 bp

FASTA

>Os09t0481700-02 class=Sequence position=chr09:18496976..18499924 (- strand)
AGTTAAACTT GATTGCTCTG TCGCATGGCC AGCAGTAGCG ACCATGGATC CCTCATGGAG GACTGGATGC CACCACCCAC
ACCCAGCCCG AGAACACTCA TGTCAAGCTT CTTGAATGAA GATTTTGTCT CTGGTTCATT TTCCAATATT TTCAGTGATC
ATGAGAGCAA CAAACCCCAG GATCAGTTTG AGAGAAACAG AGAGCTTGTG GATTTGAGTA AGGAAGTGCC TTCCCAATTC
GCAAGACCCG CATTCCAGAG GGATGCTTCC CTGGATCATA GCTTGGTCAG TCCTACACAG AGATCAAACT CGCATGGTGG
TTTGGCAGAG CGCAGGGCTG CGAGGGCTGG TTTCAGTGTC CCGAAAATCG ATACATCCCG TGGTGGTTCA TCCACAGTAA
TTCGATCGCC CGTGGCAATT CCACCAGGTC TTAGTCCAAC AACACTTCTC GAGTCACCGG TTTTCCTTTA CAACGCAATG
GTATGTCATG TTTCCACAAT TTGTTTGTTT ATGCATTATG CCCCGATAGG ATGTCTCTAG CAAGGTTGTG ATAAGCCATA
GTTAGAGTTA CTGAGTTAGT ATCAAAGACT TGCAGGTTGC AATTACCAGG CATATGAGTT TTTCTTATTT ATTTATTAAC
GAACAGACCA TGGGGTTTGG CAGTAAAGAG GACATTGATT GATGTATATT ATGTAGAACA TGATTGTGGG CAGTATCAAA
GCTTGTAAAT ACAGTAAGTA CTGAATGATG CTTACTGTTA GGAACACTAC TAGAAATGAT TTTATGACAT CTTACAATTT
TAGACATTTG TCTTGTGATT TATTATGCAT AAGTTATTTT TTAATTCATA ACTTAACAAA TATGTTTGTG CACTTCTGTT
GCGATATTTG CTATACAGGC ACAGCCTTCT CCAACCACTG GCACACTGCC ATTTTTGATG GCTTCAAATG CTAAGTCAAC
AATACCGTCA GCTACCAAGA TGGACGAAGA TTGCACATTT GGCAATGACA CTTTCTCCTT CCAACCGCAT GTAGGGTCGA
GACGGCCAAA TTTCTCCGCT GCAGAAAAGG TGATTCTTTG ACTGTCGGTC TCCATTTCAG TTTTCCTTCC AGTATTATGT
AATATTCCTT CCAGTATTAT GTAATATTGT CTCTGTTCTT TTATTGCAAA CTTCACCGCC AAAATGACCC ACCTCATTCC
TTTTAATCCT TTTGTGTTTA TTGTACAGGG TCCCAATGCT TGTCACCAAA ACCAATCGCT GTCGAATATC CATCAGCGGG
AATCCAGTCT TCAGTCAAGC TTTACTGCAG TCAAAGATAT CACTGATGAA AAAAACATTA AAACAAAGAC ATCTGACTCC
ATGTTTGGTG ATAACCACTC TTCTGATGAA CAAGATGATG AGACTAACCA AAATGGAGAA AACTCTATGC CACCTCCGAA
CCACCGTTCA GGTGTCCCTC TGTCACATAC CAATGATCCA GAAGTGAATG TCCTAGAGAA CCGCGGTTCA CAGACATGCC
ATAACTCTGC ATCCTTGTGG GACAATGCCA AAAATGATTG CCTTCAAGAT GTTCAAAGTG AAGTTATTGA AACAAGAACA
GCTGCTTGTC TTCCAGTATC AACCAATTGT GATACATCTA TCATGGAGTC CCAAGATGCA GTTGATGTGT CGTCAACACT
ATCTAATGAG GAGGATGATA GGGCAACGCA TGGCACGGCT TCTATAGAGT GCAACGGGGA TGGAGATGAG ACTGATTCCA
AGAGAAGGTT AATGCCATCT ACCACTTAAT TACTTAATGT AGGCATGAAT GCATGATAAT TCACTGATGG ATCTGGTTCT
TTTTCAGGAA GCTGGATGCT TTGACAGCTG CAACTGCTGC TATTACCACC ACCAGTAACA TTGACATGGG AGCTGCGGCA
TCGAGAGGTG TCCGGGAGCC TCGTGTTGTT GTTCAGACAA CAAGTGAGGT TGACATCCTT GATGACGGTT ACCGCTGGCG
CAAGTATGGA CAGAAGGTTG TTAAAGGAAA TCCAAACCCA AGGTCAGTTT AGTGTCACTG CATTTCTTGC AGTAATTGAT
CATGCGGCAT GCATCCTTTG ATTAATGTTT GATATTCTTG GTACCATCCT GAGATGAGTA ACATTATTTC ATTTGTCTGC
AGGAGCTATT ACAAATGTAC GCACCAAGGG TGTTCGGTGC GCAAGCACGT GGAGAGAGCA TCGCATGATC TAAAATCCGT
CATCACGACG TACGAGGGGA AGCACAACCA TGAAGTTCCA GCTGCCAGAA ATAGTGGACA TGGGAGCTCT GGATCTGGAA
ACGCTCCATC TGCACCGCAA TCTAACGGCT CTCAGCGCAG GCAAGAACAA GGGCAAGCCA GCTTCAGCCA GTTTGGTGGC
GCGGCTCCCT TCAGCTCCTT CGTTCTCCCA CCAAGAAACC AATTTGGACC ATCGGCGAGC AATTTCCCCT TTGGGATGGT
CCCGCCAGGC ATGGCGATTC CCATGCCATC TCTAGGGTCT CTTGCTCCAG CAAAGATGGC TGGTCATCCA TCCACCATGC
AGGGCTACCA GGGGCTCATG ATTCCGGAAG GAGAGATGAA GACAGAGCCC ATGTCGCAGC TCGGCTTCCC CGCGGTAAAC
CAATCTTCAT CATCCTTCCA ACAGATGATG AACAGGCCTC CATCATTTGG ACCTCAGATG TAAATAATAA TATTAAAGAA
AGAAAAGAAA ATGATAGATG TGCTTCAGCT TCTATACATG GTAGCAATGC TACAACATAG CTTTGTTGTT CTAGCTTTTA
CCTGTTATTT TTTCTTTGGG CTTTTATTTT TTGGAAGCAA AGAATGCAGA AGATGTTACC CGTTTTGTTT ATGTTGTAAT
TGGAAAAAAA AGGTGGTGGT AGTGTTCAGG ACAAAAGGCA AAATCATTCA ATTGGAAGTG CTGATGGTG