Os09t0491740-01

Locus

Os09g0491740

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS1, PILS1

Oryzabase Gene Name Synonym(s)

PIN likes 1

Transcript Evidence

AK073345 (DDBJ, Best hit)

Protein Evidence

XP_002890416.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

J033028L15 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0491740-01)

Others

Oryzabase (19845)

KEGG (Os09t0491740-01)

Transcript

2345 bp

>Os09t0491740-01 Auxin efflux carrier domain containing protein.
CGAGCAATATATATATAATCTTCAGTGAGAAAAGCCTCAGAACCACACCCTCGAGAGCCC
GAGCTGGAGAAGAAGAGAAGAAAAGGCGGCCACGGAATCGTCGGCCGCCGCCACCTCCGC
CGCCGGCGCAGAGCTCCGCCGGTATCGGCCAGGTGGCTCTTCTCCTCTCTCGGAATCGAA
GGCGAGCGCGCGCTTTAATTTCTTCATCTCCCTCCATCTTCTTCATTGGCGGCGGCGGCG
GCGGTTTTGCGGCGGCGCGTGCAGGCCAGCAAGAACGAAGCTAAGGACAGGGAACAGTGA
CTGCTTGTTGAACTAAGCTACAACAATCATGGGCCTCCTGGAGCTCTTTATTACAGCATG
TGTGCCGGTTCTGAACATGCTTCTGGTTACTGGTGTTGGATCATTCCTGGCAACTGATTT
TGTTGGCATACTGAACAAAGATGCACGGAAATATCTAAACAATATAGTATTTTATGTATT
TAATCCATCTCTTGTTGCGACCTATTTAGCACAAACAATCACATTGGAAGGCTTGGCTAA
ATTGTGGTTCATGCCTGTGAATATTCTTCTTGCTTGTACCTTTGGGTTAATCCTTGGATG
GATCGTGGTACATGTCACCAGAGCACCGGCTAGGCTAAGAGGCCTCATTTTGGGTTGCTG
TTCTGCTGGCAATTGGGGCAATATTTTTCTCATCATCATTCCTGCTCTTTGCAAAGAGAA
AGGAAGCCCGTTTGGAGCACCTGATGTTTGTCACACTTATGGATTAGCGTATTCTTCACT
CTCAATGGCTCTTGGTGCTGTCTTTCTGTGGACTGTCGCGTATAACATTATGCGAGCCAC
TTCAAAAGTGGCTGATGAAGGTAATGCTCGAACAAATGATACAAAAGTATCCAATTCAGG
GAGCAGTACAGGAACAGCGTCAGAAGAGAATTTATCAATCCCAAACGATAACAATCAATG
CACACTCCCTTTGATATCCAATTCAAGTGTACCTTCAAGCAAAACTAAGGTCACATTGTC
AGAGAGAGCGAAGCGATTTGTATCATCAATGTTCGGAGCAATTGACTTCAAGAAGATCTT
TGCTCCTTCAACCATTGCTGTGATTATTGGGTTTATAATTGGAGGAACGCCTCTAATTAG
AAATGCTATTATCGGAGAAAACGCTCCTCTTCGTGTCATTCATGAGTCAGCTGATCTAAT
AGGTGGAGGAGCAATTCCATCTGTCACACTGATAATGGGAGGGAACCTCCTCAATGGATT
ACGAGGAGAAGCAAGCGTCCAGCCTTCAGTGATAGCGAGCGTAATCGTCGTCAGATACAT
TCTTCTCCCTTCGCTAGGCACCTTGCTCGTCAAATCGGCGGTTCACCTGGGCCTCATCCA
CCCTGATCCCCTCTACCAGTTCATCCTATTGCTTCAGTACGCCGTGCCGCCGGCGATGAA
CATTGGTAGGAAAGAAAGAATGGAATAATCTTGAATACgtaaaatacatggccggtcctt
aaacttgagagcaaatgctacttagatccatacacttgaaaattgcacatttagttctac
tatcttggtttaatggactatagtaggtccaaatcttatttgaccggagctgaccgccga
tgtggcattccacgtAGGCAACACATTTACAGCCAGCCCCCTGTAGCAGCGAAGAATTGC
AATTTGCCCCTTCGTTCTACGGTACCACCCTAGAACCCACGAAAAAGACGAGGGATTTTG
TGGGTTTCAAGGTGGCACTGTAGCGCGAAGGGGCAAATCGTAATTCTTACCCCACTCATC
TTGAATCTTCATGTCAACTGAAGAATTAATACTGAATCTTGGTGTGTGTGTTTTTGGTTC
AGGGACCATCACGCAGCTGTTCGGCGTGGGGGAGAGCGAGTGCTCCGTCATCTTCGTGTG
GGTGTACGCCCTCGCCTCCGTCGCGGTGACGGTGTGGTCGGCGTTCTTCATGTGGACGCT
GTCGTGATAGATCGATCGATCGATCGGACGCCGCGTGCCGGCGTGAGGAGGTTTCAGGGG
GTTCAGAGACGACGACGGCGAGACGTACGGTGCGTTCCTCCGGCGAGACAGGATGAAGCG
ACCGGGCAAGATGACGCCGGCGAGAGGGCGGCGCGGCTGCTGCTGCATCGCATTTGCGTC
GCTGGAGAAGATGCAACGCGACATCTAGCTAAGGCAATTCATGGCGTTCGTGTTCGTTGT
CTCATTCCGAGCAAATAATGTTGTGATTTGTATTACTATCTGTAATTCGGCGTGTGTGTT
TGCCGCCACATTTTGGCTAAATTAATCGATATTTGGGCCGGGCCGGGATGGCCCAGGATC
CAGCG

CDS

1140 bp

>Os09t0491740-01 Auxin efflux carrier domain containing protein.
ATGGGCCTCCTGGAGCTCTTTATTACAGCATGTGTGCCGGTTCTGAACATGCTTCTGGTT
ACTGGTGTTGGATCATTCCTGGCAACTGATTTTGTTGGCATACTGAACAAAGATGCACGG
AAATATCTAAACAATATAGTATTTTATGTATTTAATCCATCTCTTGTTGCGACCTATTTA
GCACAAACAATCACATTGGAAGGCTTGGCTAAATTGTGGTTCATGCCTGTGAATATTCTT
CTTGCTTGTACCTTTGGGTTAATCCTTGGATGGATCGTGGTACATGTCACCAGAGCACCG
GCTAGGCTAAGAGGCCTCATTTTGGGTTGCTGTTCTGCTGGCAATTGGGGCAATATTTTT
CTCATCATCATTCCTGCTCTTTGCAAAGAGAAAGGAAGCCCGTTTGGAGCACCTGATGTT
TGTCACACTTATGGATTAGCGTATTCTTCACTCTCAATGGCTCTTGGTGCTGTCTTTCTG
TGGACTGTCGCGTATAACATTATGCGAGCCACTTCAAAAGTGGCTGATGAAGGTAATGCT
CGAACAAATGATACAAAAGTATCCAATTCAGGGAGCAGTACAGGAACAGCGTCAGAAGAG
AATTTATCAATCCCAAACGATAACAATCAATGCACACTCCCTTTGATATCCAATTCAAGT
GTACCTTCAAGCAAAACTAAGGTCACATTGTCAGAGAGAGCGAAGCGATTTGTATCATCA
ATGTTCGGAGCAATTGACTTCAAGAAGATCTTTGCTCCTTCAACCATTGCTGTGATTATT
GGGTTTATAATTGGAGGAACGCCTCTAATTAGAAATGCTATTATCGGAGAAAACGCTCCT
CTTCGTGTCATTCATGAGTCAGCTGATCTAATAGGTGGAGGAGCAATTCCATCTGTCACA
CTGATAATGGGAGGGAACCTCCTCAATGGATTACGAGGAGAAGCAAGCGTCCAGCCTTCA
GTGATAGCGAGCGTAATCGTCGTCAGATACATTCTTCTCCCTTCGCTAGGCACCTTGCTC
GTCAAATCGGCGGTTCACCTGGGCCTCATCCACCCTGATCCCCTCTACCAGTTCATCCTA
TTGCTTCAGTACGCCGTGCCGCCGGCGATGAACATTGGTAGGAAAGAAAGAATGGAATAA

Protein

380 aa

>Os09t0491740-01 Auxin efflux carrier domain containing protein.
MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNIVFYVFNPSLVATYL
AQTITLEGLAKLWFMPVNILLACTFGLILGWIVVHVTRAPARLRGLILGCCSAGNWGNIF
LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMALGAVFLWTVAYNIMRATSKVADEGNA
RTNDTKVSNSGSSTGTASEENLSIPNDNNQCTLPLISNSSVPSSKTKVTLSERAKRFVSS
MFGAIDFKKIFAPSTIAVIIGFIIGGTPLIRNAIIGENAPLRVIHESADLIGGGAIPSVT
LIMGGNLLNGLRGEASVQPSVIASVIVVRYILLPSLGTLLVKSAVHLGLIHPDPLYQFIL
LLQYAVPPAMNIGRKERME*

5'UTR

chr09:18983187..18983471 (- strand) : 285 bp

chr09:18981817..18981859 (- strand) : 43 bp

CDS

chr09:18981682..18981816 (- strand) : 135 bp

chr09:18981495..18981574 (- strand) : 80 bp

chr09:18981289..18981413 (- strand) : 125 bp

chr09:18980292..18980413 (- strand) : 122 bp

chr09:18979948..18980166 (- strand) : 219 bp

chr09:18979742..18979834 (- strand) : 93 bp

chr09:18979569..18979669 (- strand) : 101 bp

chr09:18979359..18979411 (- strand) : 53 bp

chr09:18979030..18979241 (- strand) : 212 bp

3'UTR

chr09:18978153..18979029 (- strand) : 877 bp

FASTA

>Os09t0491740-01 class=Sequence position=chr09:18978153..18983471 (- strand)
CGAGCAATAT ATATATAATC TTCAGTGAGA AAAGCCTCAG AACCACACCC TCGAGAGCCC GAGCTGGAGA AGAAGAGAAG
AAAAGGCGGC CACGGAATCG TCGGCCGCCG CCACCTCCGC CGCCGGCGCA GAGCTCCGCC GGTATCGGCC AGGTGGCTCT
TCTCCTCTCT CGGAATCGAA GGCGAGCGCG CGCTTTAATT TCTTCATCTC CCTCCATCTT CTTCATTGGC GGCGGCGGCG
GCGGTTTTGC GGCGGCGCGT GCAGGCCAGC AAGAACGAAG CTAAGGTACG CGTTCCAAGC CCTCCTCCCG TCGTCGACCT
CCTCCTCGGC CGCATGATCC CGGAGGAGAT CTCGATTCCG ACGTGTGCCC GCGCGCGTTG CTATCTCCTA TCTGCATCTG
TTTTTTTTTT AAAAAAAAAA AGAAGAAGAA GAAGAAGAAA AATTGTTCTT CAGTCAAAGC TATAGTACTC TCCCTATTGG
AGTGTGCTCA TTCGATCAGT CATCAGTCAG AGCTAGATGA TTGGCAGATG TAAGCTACAG TTTAGTTTGT CAGTAAATAG
TATAGTACAG TGCAAGCTCC ATCGTCGGCG ACGATCAGAT CAGGCTACTG ATGGCATTTG CTGCACGGCT GTGCGAATGA
GCTGCATGCA CTTGGAGTTG ATGTTAGAGT TTGTTAAAAT TAAGTTTCCA TATGAATTAG GCTAGGAATT TAGGATtcct
ccctattctc ccgattctgt ttctgtaagt cgtttagaga taaggtagtc gagctctagt attttgtacA GTTGACTGAC
TCCTTGGAGT TGTTTTGATC TTGCGCTTTG CATTGACTCA GTTCAAAGCT GTTTTGATCT TGCACTTTGC ATGGATGAGC
ATATCGATAT AGGGGTGGAT CGAAACCATG TGAAGTCTGA AACTCTGAAG CTCATTTCAC ATGCTCCTGT AGTGTTCTTC
TCCTTTGGGA GAATCTCAGT TACCTGCTCT TTTTAAAAGC TAATCTTGTG ATACTTCGCT GCATCAACTT CTTGTAGCCT
AGTGGTTGCA GTgacctgag cagtacctta aggttttgag ttcaaatctc catagaagcg aatttcagat tgggttgaat
ttcagattaa gttgtttgcg gggttaagtt cctaatttaa atggccgcat atatccggtt ggatgtagat gccgggtaaa
aaataccctt ctctaaaaaa taaaaaaaaa atcaaCTTCT TAGTTTATTT ATCCTCTAGC CCTTAGTTTT TCTTCCTTGT
GGTAGACTGG TAGTTCGCCC TTCTTCTTGT TTGGTTTCGC ATGTAGTAGA ATCCTTGGAG ACAAGGAAGA AGTAAAACTT
GTTTGGTTTC GCATGTAGTA GAATTATTGG AGACAAGGAA GAAGTAAAAC AGTTGTACAA TTTGCAATCT CTGTACCATG
GACATGACAT TTGGTCCAAT AATGGTCCTT TCTCATCATT GTAGCAAAAA AAAACGTTTT TTATTTTAGA AGTTTATCTT
TTAGACGATC AAATACGCAT TTCTCGACAT GAAACATGAG AACTATTATT AGTTGCGATG CACTTAGCAT GTTTGATGGT
TTTACTTTTC AGGACAGGGA ACAGTGACTG CTTGTTGAAC TAAGCTACAA CAATCATGGG CCTCCTGGAG CTCTTTATTA
CAGCATGTGT GCCGGTTCTG AACATGCTTC TGGTTACTGG TGTTGGATCA TTCCTGGCAA CTGATTTTGT TGGCATACTG
AACAAAGATG CACGGAAATA TCTAAACAAT GTAAGTTGTG GTGATTGGGG TAAATTCAAT TGTGCAAAAT TGTAGTAAAT
ATTTTGCTAA TACAAGCCAT ACATCATCTC TGAATAAATA AACTTTTTTG CCTGCAGATA GTATTTTATG TATTTAATCC
ATCTCTTGTT GCGACCTATT TAGCACAAAC AATCACATTG GAAGGCTTGG CTAAATTGTA AGTCTCCCAT GTTTCTTTGC
CAAACTGTCA TTGAACAACT GAAATAAAAC AATTATTTTC TTTTTACCCA CAATGCAGGT GGTTCATGCC TGTGAATATT
CTTCTTGCTT GTACCTTTGG GTTAATCCTT GGATGGATCG TGGTACATGT CACCAGAGCA CCGGCTAGGC TAAGAGGCCT
CATTTTGGGT TGCTGTTCTG CTGGTAACTA GGAGTTCCTC TGCTCTTGTA AATCGACAGC ACATATCTTT TAAAATTCAT
GCCCTTATAG TAGATAAACA TAGTACAAAT CCTTCACATA CATATTTATT GTGTGGATGT TTGGGCCCAT GTATGTTAGT
GTGGAAAACT CTTTGCTTTA TGAAGTGCTA GCTTCTCATG CTTATGCAAA GCTCCACTTA TAGTTATAAA ACTCTTATAT
TTATTTTCTG TTGGTTATTC CTCTGGAGTT TATAGTACTA CTACAAATCA ATGTCAATCT GAGTATGCAA CGCATCATGC
AAGTGTCATT GTCAAAAACA TTACCTCTTC ATGGATAACC AAATGGAAAA GCTGAGAATC AATTGTATGT ATACAGTAAG
TCATTACCAG TACCAGTCCA ATGATCCAAT CTTAAGGTGT CCCAGCATCC CACTAGGCCA TTATTGACAC AATTCAAATC
AGCCAATATG AGTACAACAG ACAAGGCTGT CTTTATATTT CAGATGGTAT AGATCAGGTA GTCCTGTTGG ACCATTGTAC
TAGCCATAAT ACTGATAACC AACCACCTCT GCTGGACTTG AACCGTACAT GTAACAAAAA GGAGATCTTA GGACAAGATC
ATGATTGAAC ATGTCGAGGA TTTATAACAT TATTTGTACA ATATTTTCTG CCAACATTGA ATGGGACACT TTAGAGGACT
AACTGAACTT GGACAGTTAC ACCTTACTAA GAGTCTGTAG TCAATTGATA CTTGATAACA TTGAATGGGA CAATTTAGAG
GACTAACTGA ACTTGAATAA TCACACCTTA GAATACTACA ACCCTCGTTT TGTTTCTTCC GGTGCCTAAC GTTGATCATT
TCCCTTGGTT GGATGCAGGC AATTGGGGCA ATATTTTTCT CATCATCATT CCTGCTCTTT GCAAAGAGAA AGGAAGCCCG
TTTGGAGCAC CTGATGTTTG TCACACTTAT GGATTAGCGT ATTCTTCACT CTCAATGGCT GTAAGGCTAT ATCTGTTTTT
TGTATCTAAA ATATTCTGCA GATAGTCGAT GCAACTGTCT TATGTTTGTG AGCTGTAATT GTGATTAAGA ACACCGGTGT
CACAATCGTC AGTGATTTGC TGCAGCTTGG TGCTGTCTTT CTGTGGACTG TCGCGTATAA CATTATGCGA GCCACTTCAA
AAGTGGCTGA TGAAGGTAAT GCTCGAACAA ATGATACAAA AGTATCCAAT TCAGGGAGCA GTACAGGAAC AGCGTCAGAA
GAGAATTTAT CAATCCCAAA CGATAACAAT CAATGCACAC TCCCTTTGAT ATCCAATTCA AGTGTACCTT CAAGCAAAAC
TAAGGTCTCT TAATGCTGGA AGAAATATTT ACCTTTTACA AGTTCAAGTT GTACACTGTT TTAGTGCACA ATGTTGTTAT
GACAATTTGT TGAATTATAA ACTTTAAATT TTCATAGGTC ACATTGTCAG AGAGAGCGAA GCGATTTGTA TCATCAATGT
TCGGAGCAAT TGACTTCAAG AAGATCTTTG CTCCTTCAAC CATTGCTGTG GTATGCTGAG TATTACAAAC TTTAACATTG
TGTTATAAAA CTATGCTGAG TATCATTTTT CATTTTGTAT AGATTATTGG GTTTATAATT GGAGGAACGC CTCTAATTAG
AAATGCTATT ATCGGAGAAA ACGCTCCTCT TCGTGTCATT CATGAGTCAG CTGATCTAAT AGGGTAACAC CTCCACATCA
TTTCTATTGT TTTCTGAACA TTCTTCATGG TGTTCCAAAT CCTATTGATC AATGATAATG CTGCCTTTTT CTCTTCATTT
TGTCCTTTTG GATTAACTCC GATCTCTAAT CATTTTTACG TGTTTTTTTT TCCTGCACAG TGGAGGAGCA ATTCCATCTG
TCACACTGAT AATGGGAGGG AACCTCCTCA ATGGTAAGCA TGCTACTATT CTCACACTAA ACAACCTGAC AGAAATACCA
GTACATTTTA CTGACGAAAA GAACAATGCC ATTAATCTGA TGACCTGAAA CATTAACTCT TTTTTTCCAG GATTACGAGG
AGAAGCAAGC GTCCAGCCTT CAGTGATAGC GAGCGTAATC GTCGTCAGAT ACATTCTTCT CCCTTCGCTA GGCACCTTGC
TCGTCAAATC GGCGGTTCAC CTGGGCCTCA TCCACCCTGA TCCCCTCTAC CAGTTCATCC TATTGCTTCA GTACGCCGTG
CCGCCGGCGA TGAACATTGG TAGGAAAGAA AGAATGGAAT AATCTTGAAT ACgtaaaata catggccggt ccttaaactt
gagagcaaat gctacttaga tccatacact tgaaaattgc acatttagtt ctactatctt ggtttaatgg actatagtag
gtccaaatct tatttgaccg gagctgaccg ccgatgtggc attccacgtA GGCAACACAT TTACAGCCAG CCCCCTGTAG
CAGCGAAGAA TTGCAATTTG CCCCTTCGTT CTACGGTACC ACCCTAGAAC CCACGAAAAA GACGAGGGAT TTTGTGGGTT
TCAAGGTGGC ACTGTAGCGC GAAGGGGCAA ATCGTAATTC TTACCCCACT CATCTTGAAT CTTCATGTCA ACTGAAGAAT
TAATACTGAA TCTTGGTGTG TGTGTTTTTG GTTCAGGGAC CATCACGCAG CTGTTCGGCG TGGGGGAGAG CGAGTGCTCC
GTCATCTTCG TGTGGGTGTA CGCCCTCGCC TCCGTCGCGG TGACGGTGTG GTCGGCGTTC TTCATGTGGA CGCTGTCGTG
ATAGATCGAT CGATCGATCG GACGCCGCGT GCCGGCGTGA GGAGGTTTCA GGGGGTTCAG AGACGACGAC GGCGAGACGT
ACGGTGCGTT CCTCCGGCGA GACAGGATGA AGCGACCGGG CAAGATGACG CCGGCGAGAG GGCGGCGCGG CTGCTGCTGC
ATCGCATTTG CGTCGCTGGA GAAGATGCAA CGCGACATCT AGCTAAGGCA ATTCATGGCG TTCGTGTTCG TTGTCTCATT
CCGAGCAAAT AATGTTGTGA TTTGTATTAC TATCTGTAAT TCGGCGTGTG TGTTTGCCGC CACATTTTGG CTAAATTAAT
CGATATTTGG GCCGGGCCGG GATGGCCCAG GATCCAGCG

Locus: Os09g0491740

Loading...

Locus: Os09g0491740

Loading...