Os09t0493500-01

Locus

Os09g0493500

Description

Similar to H0404F02.2 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTKPR1, TKPR1, OsDFR2, DFR2, OS-DFR2, OsDFR2A, DFR2A

Oryzabase Gene Name Synonym(s)

tetraketide aplha-pyrone reductase 1, Dihydroflavonol-4-reductase 2

Transcript Evidence

AK120576 (DDBJ, Best hit)

Protein Evidence

Q01KJ5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: ubiquitin-dependent protein catabolic process (GO:0006511)

Functional domain (InterPro)

Ubiquitin fusion degradation protein UFD1 (IPR004854)

Full-length cDNA

J013135C24 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0493500-01)

RiceXPro (AK120576)

Others

Oryzabase (13163)

KEGG (Os09t0493500-01)

Transcript

2231 bp

>Os09t0493500-01 Similar to H0404F02.2 protein.
ATGTTCAGAGTGTTCTCTGAATTCTTATATCTGAATTTCTGAAGACTCAACTGCCACGGG
AGGGATGGCGCAGCCGGAGACCTTGTCGCTGGCCGGGCGGCGGGTGGCGTTCACGACGCC
GCAGACCGACGCCGGCGGCGGCGGCTACGGCGGCCGGCTCCACGCCATCCTGCGGCAGCG
CGGCGCGCGGCCGGTCCCGGTGCCCACCATCGCCATCCGCGCGCACGACCCGgacatcct
ccgccccttcgtcgcgccgggcggcctcgacgccttcgcggcgctcgccttcacctcgcg
ctccggcatctccgccttctcccgcgccctcctcccgtcctcctcctcccccgcgcggcg
gccgcggcaccccgtctccgacgccgccaccgcgctacccttcaccgtcgccgccctcgg
cagcgacgccgacctcctcgacgcggcgttcctctccaggctctgcggcgacgcgggcgg
gagggtGTCGGTCCTCGTCCCCGACGTCCCCACCCCGGCCGGCCTCGTGGAGGCGCTGGG
GAGCGGGTCCGGCAGGCGCGTGCTCTGCCCCGTGCCCGACGTCGTCGGCCTACGCGAGCC
GCCGGTCGTGCCGGGCTTCCTCGCCGGGCTGGAGGCGGCCGGGTGGGTCGCCGTGCGCGC
GCCGGCGTACGTCACGTGCTGGGCGGGGCCGCGCTGCGCGGAGGCTTTGGTGGACGCCGC
GGCGCCCGACGCCGTCGTGTTCACCTCCACCGCCGAGGTGGAGGGCCTGCTCAAGGGGCT
GGACGCCGCGGGGTGGAGCTGGCCGCGGCTGCGCGCGCGCTGGCCCCGCATGGTCGTCGC
CGCGCATGGCCCCGTCACCGCCGACGGCGTCAGGAGGCTGGGCATCGAGGTCGACGTCGT
CGGCGCCAGGTTCAGCAGCTTCCATGGTGTTCTCGACGCCCTCGCCGCGAAACTCGAATC
AGATTGAAGCACTACCATTGTTCGTCCCAAATCCGAATCAATTTTAGATTTCTAAACCGA
ATCTTGTTGCGAGTTCTTCTCCTACCCATCCGCGTCTCGGGGCTTGGAATCGAATCCTCG
CCAAGTTCGGATCAACGAACTGCCCTCATAAGCccgcgtcccctccttcctcgcgtcgac
gccgcaccgcaccgcatctccgctcgccgccgccgacgacgacgagATGCTTTCCCGGAT
TCTGCATGGCTATGGAGGACACGGCGGGAGAGGCTTCGAGCAGACGTACCGGTGCTACTC
GGCGGCGGCCTTCAACAAGCCGCAGCTCGAAGGCGGAGACAAGGTGATCATGCCGGCGTC
GGCGCTCCACCGCCTCGCCTCCCTCCACATCGACTACCCGATGCTGTTCgagctctccca
ccacggcgacgccgccgcccaccgggtcacccactgcggcgtgctggagttcgtcgccga
cgagggcacggtgatcatgccgcggtggatgatgcgcggcatgcgcctcgacgacggcgg
cctcgtcgtcgtcaggagcgccagcctccccaagggcagctacgccaagctgcagcctca
caccggcgacttcctcgacacggcgaaccccaaggccgtcctggagaagacgctgcgcag
cttcacctgcctcaccaccggcgacaccatcatggtGGCCTACAACAACAAGGAGTTCCT
CATCGACATCGTCGAGACGAAGCCCGCCTCGGCCGTCTGCATCATCGAGACGGATTGCGA
GGTCGATTTCGCACCTCCACTCGATTACAAAGAACCTGAAAAGGTTCAGCAGAAACCATC
TGTTCCTTCAAGCAAGGCGGCTTCCGAAGATCAAGATCAAATCAAAGATGAGCCAGAATT
CAGAGCATTCACTGGTTCAGGGAATCGTTTGGATGGTAAGGCCTCAAAACCGCTAGCAGC
AGGGATCTCTTCTAATCCTGCTGCTGCAAGTTCTGCAATTTCAGACTCGAACAAGAAGGT
GAATCAGGAGACAGCAGCATCAGGAGTTAGCAACTCTACACGTCAGAAAAAGGGGAAGCT
TGTTTTTGGTTCAAACAAAAGCAGCAGCAGCAGCAAAGAACCAGAGAAGGCTCCTCCTGT
TAAAGTTGATGAACTTGCAAAGAAGGAAGAGCCCAAGTTCCAAGCATTTTCTGGGACGAG
CTACTCGTTGAAACGTTAGCTGCTGCTATTAGGGTTAAAAGTTTTGGAATCAATCATTTG
TTTCTTACTTG

CDS

993 bp

>Os09t0493500-01 Similar to H0404F02.2 protein.
ATGCTTTCCCGGATTCTGCATGGCTATGGAGGACACGGCGGGAGAGGCTTCGAGCAGACG
TACCGGTGCTACTCGGCGGCGGCCTTCAACAAGCCGCAGCTCGAAGGCGGAGACAAGGTG
ATCATGCCGGCGTCGGCGCTCCACCGCCTCGCCTCCCTCCACATCGACTACCCGATGCTG
TTCgagctctcccaccacggcgacgccgccgcccaccgggtcacccactgcggcgtgctg
gagttcgtcgccgacgagggcacggtgatcatgccgcggtggatgatgcgcggcatgcgc
ctcgacgacggcggcctcgtcgtcgtcaggagcgccagcctccccaagggcagctacgcc
aagctgcagcctcacaccggcgacttcctcgacacggcgaaccccaaggccgtcctggag
aagacgctgcgcagcttcacctgcctcaccaccggcgacaccatcatggtGGCCTACAAC
AACAAGGAGTTCCTCATCGACATCGTCGAGACGAAGCCCGCCTCGGCCGTCTGCATCATC
GAGACGGATTGCGAGGTCGATTTCGCACCTCCACTCGATTACAAAGAACCTGAAAAGGTT
CAGCAGAAACCATCTGTTCCTTCAAGCAAGGCGGCTTCCGAAGATCAAGATCAAATCAAA
GATGAGCCAGAATTCAGAGCATTCACTGGTTCAGGGAATCGTTTGGATGGTAAGGCCTCA
AAACCGCTAGCAGCAGGGATCTCTTCTAATCCTGCTGCTGCAAGTTCTGCAATTTCAGAC
TCGAACAAGAAGGTGAATCAGGAGACAGCAGCATCAGGAGTTAGCAACTCTACACGTCAG
AAAAAGGGGAAGCTTGTTTTTGGTTCAAACAAAAGCAGCAGCAGCAGCAAAGAACCAGAG
AAGGCTCCTCCTGTTAAAGTTGATGAACTTGCAAAGAAGGAAGAGCCCAAGTTCCAAGCA
TTTTCTGGGACGAGCTACTCGTTGAAACGTTAG

Protein

331 aa

>Os09t0493500-01 Similar to H0404F02.2 protein.
MLSRILHGYGGHGGRGFEQTYRCYSAAAFNKPQLEGGDKVIMPASALHRLASLHIDYPML
FELSHHGDAAAHRVTHCGVLEFVADEGTVIMPRWMMRGMRLDDGGLVVVRSASLPKGSYA
KLQPHTGDFLDTANPKAVLEKTLRSFTCLTTGDTIMVAYNNKEFLIDIVETKPASAVCII
ETDCEVDFAPPLDYKEPEKVQQKPSVPSSKAASEDQDQIKDEPEFRAFTGSGNRLDGKAS
KPLAAGISSNPAAASSAISDSNKKVNQETAASGVSNSTRQKKGKLVFGSNKSSSSSKEPE
KAPPVKVDELAKKEEPKFQAFSGTSYSLKR*

5'UTR

chr09:19118018..19119203 (- strand) : 1186 bp

CDS

chr09:19117025..19118017 (- strand) : 993 bp

3'UTR

chr09:19116973..19117024 (- strand) : 52 bp

FASTA

>Os09t0493500-01 class=Sequence position=chr09:19116973..19119203 (- strand)
ATGTTCAGAG TGTTCTCTGA ATTCTTATAT CTGAATTTCT GAAGACTCAA CTGCCACGGG AGGGATGGCG CAGCCGGAGA
CCTTGTCGCT GGCCGGGCGG CGGGTGGCGT TCACGACGCC GCAGACCGAC GCCGGCGGCG GCGGCTACGG CGGCCGGCTC
CACGCCATCC TGCGGCAGCG CGGCGCGCGG CCGGTCCCGG TGCCCACCAT CGCCATCCGC GCGCACGACC CGgacatcct
ccgccccttc gtcgcgccgg gcggcctcga cgccttcgcg gcgctcgcct tcacctcgcg ctccggcatc tccgccttct
cccgcgccct cctcccgtcc tcctcctccc ccgcgcggcg gccgcggcac cccgtctccg acgccgccac cgcgctaccc
ttcaccgtcg ccgccctcgg cagcgacgcc gacctcctcg acgcggcgtt cctctccagg ctctgcggcg acgcgggcgg
gagggtGTCG GTCCTCGTCC CCGACGTCCC CACCCCGGCC GGCCTCGTGG AGGCGCTGGG GAGCGGGTCC GGCAGGCGCG
TGCTCTGCCC CGTGCCCGAC GTCGTCGGCC TACGCGAGCC GCCGGTCGTG CCGGGCTTCC TCGCCGGGCT GGAGGCGGCC
GGGTGGGTCG CCGTGCGCGC GCCGGCGTAC GTCACGTGCT GGGCGGGGCC GCGCTGCGCG GAGGCTTTGG TGGACGCCGC
GGCGCCCGAC GCCGTCGTGT TCACCTCCAC CGCCGAGGTG GAGGGCCTGC TCAAGGGGCT GGACGCCGCG GGGTGGAGCT
GGCCGCGGCT GCGCGCGCGC TGGCCCCGCA TGGTCGTCGC CGCGCATGGC CCCGTCACCG CCGACGGCGT CAGGAGGCTG
GGCATCGAGG TCGACGTCGT CGGCGCCAGG TTCAGCAGCT TCCATGGTGT TCTCGACGCC CTCGCCGCGA AACTCGAATC
AGATTGAAGC ACTACCATTG TTCGTCCCAA ATCCGAATCA ATTTTAGATT TCTAAACCGA ATCTTGTTGC GAGTTCTTCT
CCTACCCATC CGCGTCTCGG GGCTTGGAAT CGAATCCTCG CCAAGTTCGG ATCAACGAAC TGCCCTCATA AGCccgcgtc
ccctccttcc tcgcgtcgac gccgcaccgc accgcatctc cgctcgccgc cgccgacgac gacgagATGC TTTCCCGGAT
TCTGCATGGC TATGGAGGAC ACGGCGGGAG AGGCTTCGAG CAGACGTACC GGTGCTACTC GGCGGCGGCC TTCAACAAGC
CGCAGCTCGA AGGCGGAGAC AAGGTGATCA TGCCGGCGTC GGCGCTCCAC CGCCTCGCCT CCCTCCACAT CGACTACCCG
ATGCTGTTCg agctctccca ccacggcgac gccgccgccc accgggtcac ccactgcggc gtgctggagt tcgtcgccga
cgagggcacg gtgatcatgc cgcggtggat gatgcgcggc atgcgcctcg acgacggcgg cctcgtcgtc gtcaggagcg
ccagcctccc caagggcagc tacgccaagc tgcagcctca caccggcgac ttcctcgaca cggcgaaccc caaggccgtc
ctggagaaga cgctgcgcag cttcacctgc ctcaccaccg gcgacaccat catggtGGCC TACAACAACA AGGAGTTCCT
CATCGACATC GTCGAGACGA AGCCCGCCTC GGCCGTCTGC ATCATCGAGA CGGATTGCGA GGTCGATTTC GCACCTCCAC
TCGATTACAA AGAACCTGAA AAGGTTCAGC AGAAACCATC TGTTCCTTCA AGCAAGGCGG CTTCCGAAGA TCAAGATCAA
ATCAAAGATG AGCCAGAATT CAGAGCATTC ACTGGTTCAG GGAATCGTTT GGATGGTAAG GCCTCAAAAC CGCTAGCAGC
AGGGATCTCT TCTAATCCTG CTGCTGCAAG TTCTGCAATT TCAGACTCGA ACAAGAAGGT GAATCAGGAG ACAGCAGCAT
CAGGAGTTAG CAACTCTACA CGTCAGAAAA AGGGGAAGCT TGTTTTTGGT TCAAACAAAA GCAGCAGCAG CAGCAAAGAA
CCAGAGAAGG CTCCTCCTGT TAAAGTTGAT GAACTTGCAA AGAAGGAAGA GCCCAAGTTC CAAGCATTTT CTGGGACGAG
CTACTCGTTG AAACGTTAGC TGCTGCTATT AGGGTTAAAA GTTTTGGAAT CAATCATTTG TTTCTTACTT G

Locus: Os09g0493500

Loading...

Locus: Os09g0493500

Loading...