Os09t0493500-02

Locus

Os09g0493500

Description

Tetraketide aplha-pyrone reductase, Anther cuticle development, Pollen wall formation

RAP-DB Gene Symbol Synonym(s)

OsTKPR1, OsDFR2

RAP-DB Gene Name Synonym(s)

tetraketide aplha-pyrone reductase 1, Dihydroflavonol-4-reductase 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTKPR1, TKPR1, OsDFR2, DFR2, OS-DFR2, OsDFR2A, DFR2A

Oryzabase Gene Name Synonym(s)

tetraketide aplha-pyrone reductase 1, Dihydroflavonol-4-reductase 2

Transcript Evidence

AK099770

Protein Evidence

Q0J0M1

Literature

PMID: 30885140

Note

Manual Curation

March 28, 2019

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD(P)-binding domain superfamily (IPR036291)

NAD-dependent epimerase/dehydratase (IPR001509)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Full-length cDNA

J013095D01 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0493500-02)

RiceXPro (AK099770)

Others

Oryzabase (13163)

Transcript

2835 bp

>Os09t0493500-02 Tetraketide aplha-pyrone reductase, Anther cuticle development, Pollen wall formation
TTTTAGATTTCTAAACCGAATCTTGTTGCGAGTTCTTCTCCTACCCATCCGCGTCTCGGG
GCTTGGAATCGAATCCTCGCCAAGTTCGGATCAACGAACTGCCCTCATAAGCccgcgtcc
cctccttcctcgcgtcgacgccgcaccgcaccgcatctccgctcgccgccgccgacgacg
acgagATGCTTTCCCGGATTCTGCATGGCTATGGAGGACACGGCGGGAGAGGCTTCGAGC
AGACGTACCGGTGCTACTCGGCGGCGGCCTTCAACAAGCCGCAGCTCGAAGGCGGAGACA
AGGTGATCATGCCGGCGTCGGCGCTCCACCGCCTCGCCTCCCTCCACATCGACTACCCGA
TGCTGTTCgagctctcccaccacggcgacgccgccgcccaccgggtcacccactgcggcg
tgctggagttcgtcgccgacgagggcacggtgatcatgccgcggtggatgatgcgcggca
tgcgcctcgacgacggcggcctcgtcgtcgtcaggagcgccagcctccccaagggcagct
acgccaagctgcagcctcacaccggcgacttcctcgacacggcgaaccccaaggccgtcc
tggagaagacgctgcgcagcttcacctgcctcaccaccggcgacaccatcatggtGGCCT
ACAACAACAAGGAGTTCCTCATCGACATCGTCGAGACGAAGCCCGCCTCGGCCGTCTGCA
TCATCGAGACGGATTGCGAGGTCGATTTCGCACCTCCACTCGATTACAAAGAACCTGAAA
AGGTTCAGCAGAAACCATCTGTTCCTTCAAGCAAGGCGGCTTCCGAAGATCAAGATCAAA
TCAAAGATGAGCCAGAATTCAGAGCATTCACTGGTTCAGGGAATCGTTTGGATGGTAAGG
CCTCAAAACCGCTAGCAGCAGGGATCTCTTCTAATCCTGCTGCTGCAAGTTCTGCAATTT
CAGACTCGAACAAGAAGGTGAATCAGGAGACAGCAGCATCAGGAGTTAGCAACTCTACAC
GTCAGAAAAAGGGGAAGCTTGTTTTTGGTTCAAACAAAAGCAGCAGCAGCAGCAAAGAAC
CAGAGAAGGCTCCTCCTGTTAAAGTTGATGAACTTGCAAAGAAGGAAGAGCCCAAGTTCC
AAGCATTTTCTGGGACGAGCTACTCGTTGAAACGTTAGCTGCTGCTATTAGGGTTAAAAG
TTTTGGAATCAATCATTTGTTTCTTACTTGGAGTTCGCCTGGTTACTCTGGCAGCTGTAA
ATGATTGGTAGCAATGTGTATCTTTATCATTTTCAGTTCTCCCTTAATAATTCTAGTTAT
TGTCTTGCTAATTAAAAGAATTCCGTGGATTACATGGAACCTGATACTATTTGCTTGACC
ATATGTGGAGTTTTCTTGCAATGTCAAGCAGAACGCATTGCTAATGTACTCAACCAACTC
CCTACCTAGAGAAGATTCTAACTGAATCTACCCTCAACCAACCTGCTTCTCCATCAGTTA
ATTATGATCACAAAAATGAGGTGATGTACAACATTTCTTGGTCCTCCTCCTCTAGGATAT
TTCTTTGCTGTGCTTATATGAGCAGGTTGATTTGCTTCAGAGTTCAACATCATCACTTCC
AGTTTGAGAAAATGGTGATCTCATCCAAGGGCAAAGTGTGTGTAACTGGTGCTTCAGGCT
TCGTCGCCTCTTGGCTCATCAAGAGGCTTCTTGAGGCGGGCTATCATGTGATAGGAACTG
TGAGAGACCCAAGCAATCGCGATAAAGTGTCACACCTTTGGAGATTACCAAGTGCAAAGG
AGAGGCTGCAACTTGTGAGAGCTGATCTGATGGAAGAAGGGAGCTTTGACGATGCTGTGA
TGGCTTGCGAAGGCGTCTTCCACACTGCATCGCCTGTCCTTGCCAAATCTGATTCCAATT
GCAAGGAAGAAATGCTTGTTCCTGCGATAAATGGTACTCTGAATGTGCTGAAATCTTGCA
AGAAGAATCCATTTCTGAAAAGGGTTGTTCTTACATCCTCATCATCCACGGTAAGAATCA
GGGATGAGAGTAAACATCCAGAAATCTCACTGGATGAAACAATATGGAGCTCTGTGGCAC
TCTGTGAAAAGCTACAGCTATGGTATGCCCTGGCAAAGATATCTGCAGAGAAAGCGGCAT
GGGAGTTTGCCAAGGAGAACAACATTGACCTTGTAACTGTTCTTCCATCATTTGTGATTG
GGCCCAGTTTATCACATGAACTGTCTGTCACTGCTTCAGACATCCTTGGCTTACTTCAAG
GTGACACAGATAGATTCATCTCGTATGGGAGAATGGGATATGTTCACATCGACGATGTGG
CGAGCTGCCACATTCTGGTGTACGAAGCACCTCAGGCTACTGGGAGATATCTCTGCAACT
CCGTTGTTCTTGACAACAACGAATTAGTCGCCTTGCTTGCGAAGCAATTTCCAATTTTTC
CCATCCCAAGGAGCTTGAGGAACCCATATGAGAAACAGTCATATGAGCTAAACACATCCA
AGATCCAGCAGCTGGGTTTCAAGTTCAAAGGGGTGCAAGAGATGTTTGGTGATTGTGTCG
AGTCGCTGAAAGATCAGGGACACTTGCTGGAGTGCCCGTTGTAACGAAAAAAAGGGATCT
TTGGCACGGTACCAACAAGCTCATGGCCAAGCACACACTTGAATTGTTCTGACTTTGATT
CGACACTTCGCATGCCACTGCGTTTCTCTTGTAATAATTCGCATGTCATTCCCTCACCAA
ACGACAAATAAATTGTCAATTTGTTGCTCAGTCTTCACAGACCATATGCTTAAATGTAAT
GCTCTGCTTGCTTTC

CDS

1101 bp

>Os09t0493500-02 Tetraketide aplha-pyrone reductase, Anther cuticle development, Pollen wall formation
ATGTACAACATTTCTTGGTCCTCCTCCTCTAGGATATTTCTTTGCTGTGCTTATATGAGC
AGGTTGATTTGCTTCAGAGTTCAACATCATCACTTCCAGTTTGAGAAAATGGTGATCTCA
TCCAAGGGCAAAGTGTGTGTAACTGGTGCTTCAGGCTTCGTCGCCTCTTGGCTCATCAAG
AGGCTTCTTGAGGCGGGCTATCATGTGATAGGAACTGTGAGAGACCCAAGCAATCGCGAT
AAAGTGTCACACCTTTGGAGATTACCAAGTGCAAAGGAGAGGCTGCAACTTGTGAGAGCT
GATCTGATGGAAGAAGGGAGCTTTGACGATGCTGTGATGGCTTGCGAAGGCGTCTTCCAC
ACTGCATCGCCTGTCCTTGCCAAATCTGATTCCAATTGCAAGGAAGAAATGCTTGTTCCT
GCGATAAATGGTACTCTGAATGTGCTGAAATCTTGCAAGAAGAATCCATTTCTGAAAAGG
GTTGTTCTTACATCCTCATCATCCACGGTAAGAATCAGGGATGAGAGTAAACATCCAGAA
ATCTCACTGGATGAAACAATATGGAGCTCTGTGGCACTCTGTGAAAAGCTACAGCTATGG
TATGCCCTGGCAAAGATATCTGCAGAGAAAGCGGCATGGGAGTTTGCCAAGGAGAACAAC
ATTGACCTTGTAACTGTTCTTCCATCATTTGTGATTGGGCCCAGTTTATCACATGAACTG
TCTGTCACTGCTTCAGACATCCTTGGCTTACTTCAAGGTGACACAGATAGATTCATCTCG
TATGGGAGAATGGGATATGTTCACATCGACGATGTGGCGAGCTGCCACATTCTGGTGTAC
GAAGCACCTCAGGCTACTGGGAGATATCTCTGCAACTCCGTTGTTCTTGACAACAACGAA
TTAGTCGCCTTGCTTGCGAAGCAATTTCCAATTTTTCCCATCCCAAGGAGCTTGAGGAAC
CCATATGAGAAACAGTCATATGAGCTAAACACATCCAAGATCCAGCAGCTGGGTTTCAAG
TTCAAAGGGGTGCAAGAGATGTTTGGTGATTGTGTCGAGTCGCTGAAAGATCAGGGACAC
TTGCTGGAGTGCCCGTTGTAA

Protein

367 aa

>Os09t0493500-02 Tetraketide aplha-pyrone reductase, Anther cuticle development, Pollen wall formation
MYNISWSSSSRIFLCCAYMSRLICFRVQHHHFQFEKMVISSKGKVCVTGASGFVASWLIK
RLLEAGYHVIGTVRDPSNRDKVSHLWRLPSAKERLQLVRADLMEEGSFDDAVMACEGVFH
TASPVLAKSDSNCKEEMLVPAINGTLNVLKSCKKNPFLKRVVLTSSSSTVRIRDESKHPE
ISLDETIWSSVALCEKLQLWYALAKISAEKAAWEFAKENNIDLVTVLPSFVIGPSLSHEL
SVTASDILGLLQGDTDRFISYGRMGYVHIDDVASCHILVYEAPQATGRYLCNSVVLDNNE
LVALLAKQFPIFPIPRSLRNPYEKQSYELNTSKIQQLGFKFKGVQEMFGDCVESLKDQGH
LLECPL*

5'UTR

chr09:19116680..19118202 (- strand) : 1523 bp

CDS

chr09:19116451..19116679 (- strand) : 229 bp

chr09:19116174..19116347 (- strand) : 174 bp

chr09:19115872..19116062 (- strand) : 191 bp

chr09:19115613..19115775 (- strand) : 163 bp

chr09:19115263..19115455 (- strand) : 193 bp

chr09:19114990..19115140 (- strand) : 151 bp

3'UTR

chr09:19114779..19114989 (- strand) : 211 bp

FASTA

>Os09t0493500-02 class=Sequence position=chr09:19114779..19118202 (- strand)
TTTTAGATTT CTAAACCGAA TCTTGTTGCG AGTTCTTCTC CTACCCATCC GCGTCTCGGG GCTTGGAATC GAATCCTCGC
CAAGTTCGGA TCAACGAACT GCCCTCATAA GCccgcgtcc cctccttcct cgcgtcgacg ccgcaccgca ccgcatctcc
gctcgccgcc gccgacgacg acgagATGCT TTCCCGGATT CTGCATGGCT ATGGAGGACA CGGCGGGAGA GGCTTCGAGC
AGACGTACCG GTGCTACTCG GCGGCGGCCT TCAACAAGCC GCAGCTCGAA GGCGGAGACA AGGTGATCAT GCCGGCGTCG
GCGCTCCACC GCCTCGCCTC CCTCCACATC GACTACCCGA TGCTGTTCga gctctcccac cacggcgacg ccgccgccca
ccgggtcacc cactgcggcg tgctggagtt cgtcgccgac gagggcacgg tgatcatgcc gcggtggatg atgcgcggca
tgcgcctcga cgacggcggc ctcgtcgtcg tcaggagcgc cagcctcccc aagggcagct acgccaagct gcagcctcac
accggcgact tcctcgacac ggcgaacccc aaggccgtcc tggagaagac gctgcgcagc ttcacctgcc tcaccaccgg
cgacaccatc atggtGGCCT ACAACAACAA GGAGTTCCTC ATCGACATCG TCGAGACGAA GCCCGCCTCG GCCGTCTGCA
TCATCGAGAC GGATTGCGAG GTCGATTTCG CACCTCCACT CGATTACAAA GAACCTGAAA AGGTTCAGCA GAAACCATCT
GTTCCTTCAA GCAAGGCGGC TTCCGAAGAT CAAGATCAAA TCAAAGATGA GCCAGAATTC AGAGCATTCA CTGGTTCAGG
GAATCGTTTG GATGGTAAGG CCTCAAAACC GCTAGCAGCA GGGATCTCTT CTAATCCTGC TGCTGCAAGT TCTGCAATTT
CAGACTCGAA CAAGAAGGTG AATCAGGAGA CAGCAGCATC AGGAGTTAGC AACTCTACAC GTCAGAAAAA GGGGAAGCTT
GTTTTTGGTT CAAACAAAAG CAGCAGCAGC AGCAAAGAAC CAGAGAAGGC TCCTCCTGTT AAAGTTGATG AACTTGCAAA
GAAGGAAGAG CCCAAGTTCC AAGCATTTTC TGGGACGAGC TACTCGTTGA AACGTTAGCT GCTGCTATTA GGGTTAAAAG
TTTTGGAATC AATCATTTGT TTCTTACTTG GAGTTCGCCT GGTTACTCTG GCAGCTGTAA ATGATTGGTA GCAATGTGTA
TCTTTATCAT TTTCAGTTCT CCCTTAATAA TTCTAGTTAT TGTCTTGCTA ATTAAAAGAA TTCCGTGGAT TACATGGAAC
CTGATACTAT TTGCTTGACC ATATGTGGAG TTTTCTTGCA ATGTCAAGCA GAACGCATTG CTAATGTACT CAACCAACTC
CCTACCTAGA GAAGATTCTA ACTGAATCTA CCCTCAACCA ACCTGCTTCT CCATCAGTTA ATTATGATCA CAAAAATGAG
GTGATGTACA ACATTTCTTG GTCCTCCTCC TCTAGGATAT TTCTTTGCTG TGCTTATATG AGCAGGTTGA TTTGCTTCAG
AGTTCAACAT CATCACTTCC AGTTTGAGAA AATGGTGATC TCATCCAAGG GCAAAGTGTG TGTAACTGGT GCTTCAGGCT
TCGTCGCCTC TTGGCTCATC AAGAGGCTTC TTGAGGCGGG CTATCATGTG ATAGGAACTG TGAGAGACCC AAGTATGTGT
AGCATTTTTC TTGATTATGA CAGTGCATCA GTTCATTACT ACTATTCACA ACTGTGAGAT TAATTATGGT GTGTGTGTTT
TGGATAATTT AACAGGCAAT CGCGATAAAG TGTCACACCT TTGGAGATTA CCAAGTGCAA AGGAGAGGCT GCAACTTGTG
AGAGCTGATC TGATGGAAGA AGGGAGCTTT GACGATGCTG TGATGGCTTG CGAAGGCGTC TTCCACACTG CATCGCCTGT
CCTTGCCAAA TCTGATTCCA ATTGCAAGGC ATGATAAAAT TACTTCCAAT CTTCGGTTTT TATGATGCAT CTGAATGTTT
ATTTACCTGA ACTGTTATAC TACACTCTCA CTGCATGGTG CATGCTATTA CTGTTGCAGG AAGAAATGCT TGTTCCTGCG
ATAAATGGTA CTCTGAATGT GCTGAAATCT TGCAAGAAGA ATCCATTTCT GAAAAGGGTT GTTCTTACAT CCTCATCATC
CACGGTAAGA ATCAGGGATG AGAGTAAACA TCCAGAAATC TCACTGGATG AAACAATATG GAGCTCTGTG GCACTCTGTG
AAAAGCTACA GGTGAAAAGT CCATTTCGGT TTACAGATTA TTTGCACCTT TTGTGACCCA TATAAACCTT TGATTTAACA
ACGCTACTGA TATTTATGTG CATGAAGCTA TGGTATGCCC TGGCAAAGAT ATCTGCAGAG AAAGCGGCAT GGGAGTTTGC
CAAGGAGAAC AACATTGACC TTGTAACTGT TCTTCCATCA TTTGTGATTG GGCCCAGTTT ATCACATGAA CTGTCTGTCA
CTGCTTCAGA CATCCTTGGC TTACTTCAAG GTATTTCTTG TTTCTTCTGG AATCACTATT TATCTCTGAA AGGTTGCTGC
AAATACCGTT TACTCTTCTC TTCTACTGTT TTTCTTCAAA CTTTAATCTT TCTTAGCTAC TCAGCTAACG AAATGGGTTG
CTATTTGCCA ATGGAATGAT CTTGCAGGTG ACACAGATAG ATTCATCTCG TATGGGAGAA TGGGATATGT TCACATCGAC
GATGTGGCGA GCTGCCACAT TCTGGTGTAC GAAGCACCTC AGGCTACTGG GAGATATCTC TGCAACTCCG TTGTTCTTGA
CAACAACGAA TTAGTCGCCT TGCTTGCGAA GCAATTTCCA ATTTTTCCCA TCCCAAGGAG GTCAGTCAAT TGAAACACTT
AAATCCCTTG CATCTCTGAT GCTTACAACT TAATTACAAG CAGTTTTGTT TACTGTATTT TTGTTTACTG AAACTCTCGT
CTTGGAATTA ATTGCTGTGC AGCTTGAGGA ACCCATATGA GAAACAGTCA TATGAGCTAA ACACATCCAA GATCCAGCAG
CTGGGTTTCA AGTTCAAAGG GGTGCAAGAG ATGTTTGGTG ATTGTGTCGA GTCGCTGAAA GATCAGGGAC ACTTGCTGGA
GTGCCCGTTG TAACGAAAAA AAGGGATCTT TGGCACGGTA CCAACAAGCT CATGGCCAAG CACACACTTG AATTGTTCTG
ACTTTGATTC GACACTTCGC ATGCCACTGC GTTTCTCTTG TAATAATTCG CATGTCATTC CCTCACCAAA CGACAAATAA
ATTGTCAATT TGTTGCTCAG TCTTCACAGA CCATATGCTT AAATGTAATG CTCTGCTTGC TTTC

Locus: Os09g0493500

Loading...

Locus: Os09g0493500

Loading...