Os09t0493700-01

Locus

Os09g0493700

Description

NUE (nitrogen use efficiency)-related transcription factor

RAP-DB Gene Symbol Synonym(s)

OsNAC42, NAC42

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC42

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 42

Oryzabase Gene Symbol Synonym(s)

OsNAC42, ONAC042, ONAC42, ONAC051, ONAC51, OsNTL4, NTL4

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 042, NAC domain-containing protein 42, NAC domain-containing protein 51, NAC membrane-bound transcription factor 4, NAC MTF4

Transcript Evidence

AK099237

AK068501

Protein Evidence

Q0J0L8

Literature

PMID: 31754193

Note

Manual Curation

December 11, 2019

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013112C23 (Online Clone Ordering)

J013155B08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0493700-01)

RiceXPro (AK099237)

Others

Oryzabase (11482)

KEGG (Os09t0493700-01)

Transcript

2532 bp

>Os09t0493700-01 NUE (nitrogen use efficiency)-related transcription factor
GAGTTGACTCGCCATTTCGCCATTTCGTCGAGAGGTTGCTGTGCCAGTCACCAACCCATT
CCGGCGGCGGCGGCGGAGGAGACCGAGATGGGGATGGAGAACCCGCCGCTCCGGTGgccg
ccggggttccgcttcagcccgaccgacgaggagctcgtcctctacttcctcaagcgccgg
atcgccaccggccgccccaccccctacatcgccgacgtcgacgtctacaagtcccacccc
tcccacctccctgAGAGGTCGGCGCTGCGGAcgggggacaagcagtggttcttcttcagc
cggatggaccgcaagtaccccaacggctcgcgggcgagccgcaccaccggcgagggctac
tggaaggccaccgggaaggaccgctccatctgcaacggcggcggcggcggcaccgcctcg
gggcgcgcggtggggagcaagaagaccctcgtgtaccaccacggccgcgccccgcgcggg
gagcgctcggactgggtcatgcacgagtacaccctcctcgccgacgcgctcccGCCCGCC
GCGCGCGACCGCGAGGCGTACGCTCTGTACAAGCTGTTCCACAAGAGCGGCGCCGGGCCC
AAGAACGGCGAGCAGTACGGCGCCCCCTTCCGGGAGGAGGATTGGCTCGACGACGACGAC
CACCACCACGACCAGCTTCCTGCTGAGGCGGCTCTTCCGGCTCCAGCCACAACTAGTGGT
AGAGCTGCAACAACTGAGGAGCATGCTGACTTTGAGCTTCCGGGTGGGGATCTTGATGTG
CTCCTTGCGCAAATTGAAAATGATCAGGATATAATCGAAGCGCAATTGGATTTCTCAACT
CATGTTACTTCCCAAGTTCAGATTCAGCATCGTGTTCATCAAGGTTGGCTCAGTGATGAT
GGCGGAAAATCAGATGTTGCGGATGCTACGACTAGTGGCAGTGCTTTGTTGATGGCAGAG
AATACGTGCGCTGAACTTCCAATTGATGGTCTCGAGCAACTTCTGATGCAAATATCGGAT
GATCAACAGACAGTTGAAATGCTCTCTGGTTTCTCAGCATCCGTTCCCCAATCGCAGCTT
CAACATGATTATCATCAGGGTTGTCTTGGTGTTCATAGGGAGGAGGTTGGTGTTGCAGAT
TCTACCACTGTTAGTAGTGCTGTGGTGACAGAAGAATGTACTGTCCGTGAGCTTCAGGAT
ATTGAAGGGCTTCTGATGCAAATAGAAAATGACCAGGAAAATGCCGAATCACTGCCAGAT
TTCTCCACACCAGTTCATCTCCATGATTGTCATCAGGCCGCCTTCGGAGATTTTCAAGGA
AGCCAGAGGGCTACATTCAACATTGCAAATCTTTCTACTATGGTGCAGGAAAGCCCAAAT
TTTGATCTGCAAACTGGTCCAAGTAATCAAATTACTGAGTCTATTCTCACCACCGAGCCA
ATGAATGGAGAAACAAATGCTGTGGAAGAAACAAGTCCTCTGCGCTCTATGTCAGTATTG
GGTAGTTATGATAGGCAGGATGGTGATGATGAATTCCTTGAAATCAATGATTTCTTCGAC
CCAGAAGATTTAGAACAGATTTTGGGCAGTACAAGAAGTCAGAACTTGATTCCTGCTGAT
GATGGAGTGTTTGATAGTTTGCAATACTCTGATGCTCCAATGTTTCTGCCTGGTTCATTT
GACAGAACTGGTGTGGTGGCTGAAAACCATTATGTTGAATTTGGTGCTAGTGGAATTCAG
AACCAGGGATTTCAGCATACAACTGAATTATTGGCACATAATCAAGTCGCTCTAAATGTG
CGGAACCATATGAAGGACAACCATGTTGTCTTCTCACATTCATCAGATGCTACCATTATT
CATACAGTGAATGAGCAACCGCCTAACCGGAGTTCAAATGCTTCACAATCATGGTTCAAT
GGGGCTCTATCTGCCTTGCTCGATTCTGTTCCTAGCAGTCCAGCTATGGCTGCTGAAAAC
ATAGGTCTTAACAGAACACTGCAACGCATTTCGAGCTTTAGGTCACAACAACCTGCAAGA
GAAGAAGTTAGCAGTACTCTTATCAACACCAGAAGAAGAGGCGGTGGGCTAATTTTCATC
TCGTTAATGGTTTTACTTGTTGCTATCATGTGGACCTTTAGCAATGGGTCTGCAGTCAAG
CTTAGCAAGGGGTTATGGAAGTTTCCCTCTACATAATAGGATGCACCCGGTTATCCTGGT
GGCCAGTGCTTCTTACTACTTCAAGTACTAATTCTTGTTTTGCTATCCTTTCCTCTATTC
CTTTACATTGAAAAAGGCAACAATCTAGGAAAATATTAGAGGATTATGTGGTGTTAGCAC
TTACTTTCAGAATATTATGCGAGAGATGTTAAAACAAAACAAAATGAGAAAAAGAAACAT
CTGAGGTGAACTTCTGGATGTTTTTGTCCTCATCATTTTGATGAAAGTATATATTGAATG
TAATTAAACGATGATGGATTGTTGAGAAGTGCAGTTGCTGTGCACGATAAATGAAAAATC
CATTTTTGTTGC

CDS

2109 bp

>Os09t0493700-01 NUE (nitrogen use efficiency)-related transcription factor
ATGGGGATGGAGAACCCGCCGCTCCGGTGgccgccggggttccgcttcagcccgaccgac
gaggagctcgtcctctacttcctcaagcgccggatcgccaccggccgccccaccccctac
atcgccgacgtcgacgtctacaagtcccacccctcccacctccctgAGAGGTCGGCGCTG
CGGAcgggggacaagcagtggttcttcttcagccggatggaccgcaagtaccccaacggc
tcgcgggcgagccgcaccaccggcgagggctactggaaggccaccgggaaggaccgctcc
atctgcaacggcggcggcggcggcaccgcctcggggcgcgcggtggggagcaagaagacc
ctcgtgtaccaccacggccgcgccccgcgcggggagcgctcggactgggtcatgcacgag
tacaccctcctcgccgacgcgctcccGCCCGCCGCGCGCGACCGCGAGGCGTACGCTCTG
TACAAGCTGTTCCACAAGAGCGGCGCCGGGCCCAAGAACGGCGAGCAGTACGGCGCCCCC
TTCCGGGAGGAGGATTGGCTCGACGACGACGACCACCACCACGACCAGCTTCCTGCTGAG
GCGGCTCTTCCGGCTCCAGCCACAACTAGTGGTAGAGCTGCAACAACTGAGGAGCATGCT
GACTTTGAGCTTCCGGGTGGGGATCTTGATGTGCTCCTTGCGCAAATTGAAAATGATCAG
GATATAATCGAAGCGCAATTGGATTTCTCAACTCATGTTACTTCCCAAGTTCAGATTCAG
CATCGTGTTCATCAAGGTTGGCTCAGTGATGATGGCGGAAAATCAGATGTTGCGGATGCT
ACGACTAGTGGCAGTGCTTTGTTGATGGCAGAGAATACGTGCGCTGAACTTCCAATTGAT
GGTCTCGAGCAACTTCTGATGCAAATATCGGATGATCAACAGACAGTTGAAATGCTCTCT
GGTTTCTCAGCATCCGTTCCCCAATCGCAGCTTCAACATGATTATCATCAGGGTTGTCTT
GGTGTTCATAGGGAGGAGGTTGGTGTTGCAGATTCTACCACTGTTAGTAGTGCTGTGGTG
ACAGAAGAATGTACTGTCCGTGAGCTTCAGGATATTGAAGGGCTTCTGATGCAAATAGAA
AATGACCAGGAAAATGCCGAATCACTGCCAGATTTCTCCACACCAGTTCATCTCCATGAT
TGTCATCAGGCCGCCTTCGGAGATTTTCAAGGAAGCCAGAGGGCTACATTCAACATTGCA
AATCTTTCTACTATGGTGCAGGAAAGCCCAAATTTTGATCTGCAAACTGGTCCAAGTAAT
CAAATTACTGAGTCTATTCTCACCACCGAGCCAATGAATGGAGAAACAAATGCTGTGGAA
GAAACAAGTCCTCTGCGCTCTATGTCAGTATTGGGTAGTTATGATAGGCAGGATGGTGAT
GATGAATTCCTTGAAATCAATGATTTCTTCGACCCAGAAGATTTAGAACAGATTTTGGGC
AGTACAAGAAGTCAGAACTTGATTCCTGCTGATGATGGAGTGTTTGATAGTTTGCAATAC
TCTGATGCTCCAATGTTTCTGCCTGGTTCATTTGACAGAACTGGTGTGGTGGCTGAAAAC
CATTATGTTGAATTTGGTGCTAGTGGAATTCAGAACCAGGGATTTCAGCATACAACTGAA
TTATTGGCACATAATCAAGTCGCTCTAAATGTGCGGAACCATATGAAGGACAACCATGTT
GTCTTCTCACATTCATCAGATGCTACCATTATTCATACAGTGAATGAGCAACCGCCTAAC
CGGAGTTCAAATGCTTCACAATCATGGTTCAATGGGGCTCTATCTGCCTTGCTCGATTCT
GTTCCTAGCAGTCCAGCTATGGCTGCTGAAAACATAGGTCTTAACAGAACACTGCAACGC
ATTTCGAGCTTTAGGTCACAACAACCTGCAAGAGAAGAAGTTAGCAGTACTCTTATCAAC
ACCAGAAGAAGAGGCGGTGGGCTAATTTTCATCTCGTTAATGGTTTTACTTGTTGCTATC
ATGTGGACCTTTAGCAATGGGTCTGCAGTCAAGCTTAGCAAGGGGTTATGGAAGTTTCCC
TCTACATAA

Protein

703 aa

>Os09t0493700-01 NUE (nitrogen use efficiency)-related transcription factor
MGMENPPLRWPPGFRFSPTDEELVLYFLKRRIATGRPTPYIADVDVYKSHPSHLPERSAL
RTGDKQWFFFSRMDRKYPNGSRASRTTGEGYWKATGKDRSICNGGGGGTASGRAVGSKKT
LVYHHGRAPRGERSDWVMHEYTLLADALPPAARDREAYALYKLFHKSGAGPKNGEQYGAP
FREEDWLDDDDHHHDQLPAEAALPAPATTSGRAATTEEHADFELPGGDLDVLLAQIENDQ
DIIEAQLDFSTHVTSQVQIQHRVHQGWLSDDGGKSDVADATTSGSALLMAENTCAELPID
GLEQLLMQISDDQQTVEMLSGFSASVPQSQLQHDYHQGCLGVHREEVGVADSTTVSSAVV
TEECTVRELQDIEGLLMQIENDQENAESLPDFSTPVHLHDCHQAAFGDFQGSQRATFNIA
NLSTMVQESPNFDLQTGPSNQITESILTTEPMNGETNAVEETSPLRSMSVLGSYDRQDGD
DEFLEINDFFDPEDLEQILGSTRSQNLIPADDGVFDSLQYSDAPMFLPGSFDRTGVVAEN
HYVEFGASGIQNQGFQHTTELLAHNQVALNVRNHMKDNHVVFSHSSDATIIHTVNEQPPN
RSSNASQSWFNGALSALLDSVPSSPAMAAENIGLNRTLQRISSFRSQQPAREEVSSTLIN
TRRRGGGLIFISLMVLLVAIMWTFSNGSAVKLSKGLWKFPST*

5'UTR

chr09:19124946..19125032 (- strand) : 87 bp

CDS

chr09:19124780..19124945 (- strand) : 166 bp

chr09:19123648..19124690 (- strand) : 1043 bp

chr09:19122846..19123395 (- strand) : 550 bp

chr09:19122295..19122644 (- strand) : 350 bp

3'UTR

chr09:19121959..19122294 (- strand) : 336 bp

FASTA

>Os09t0493700-01 class=Sequence position=chr09:19121959..19125032 (- strand)
GAGTTGACTC GCCATTTCGC CATTTCGTCG AGAGGTTGCT GTGCCAGTCA CCAACCCATT CCGGCGGCGG CGGCGGAGGA
GACCGAGATG GGGATGGAGA ACCCGCCGCT CCGGTGgccg ccggggttcc gcttcagccc gaccgacgag gagctcgtcc
tctacttcct caagcgccgg atcgccaccg gccgccccac cccctacatc gccgacgtcg acgtctacaa gtcccacccc
tcccacctcc ctggtaacca CTCCCCCCCT CCTCCTCCCC CGTCGTCGAT TCCTTCTCCT GCACGACCTC ACCGTGGAAT
CGTGTTGCCG GCGGCGGAGC AGAGAGGTCG GCGCTGCGGA cgggggacaa gcagtggttc ttcttcagcc ggatggaccg
caagtacccc aacggctcgc gggcgagccg caccaccggc gagggctact ggaaggccac cgggaaggac cgctccatct
gcaacggcgg cggcggcggc accgcctcgg ggcgcgcggt ggggagcaag aagaccctcg tgtaccacca cggccgcgcc
ccgcgcgggg agcgctcgga ctgggtcatg cacgagtaca ccctcctcgc cgacgcgctc ccGCCCGCCG CGCGCGACCG
CGAGGCGTAC GCTCTGTACA AGCTGTTCCA CAAGAGCGGC GCCGGGCCCA AGAACGGCGA GCAGTACGGC GCCCCCTTCC
GGGAGGAGGA TTGGCTCGAC GACGACGACC ACCACCACGA CCAGCTTCCT GCTGAGGCGG CTCTTCCGGC TCCAGCCACA
ACTAGTGGTA GAGCTGCAAC AACTGAGGAG CATGCTGACT TTGAGCTTCC GGGTGGGGAT CTTGATGTGC TCCTTGCGCA
AATTGAAAAT GATCAGGATA TAATCGAAGC GCAATTGGAT TTCTCAACTC ATGTTACTTC CCAAGTTCAG ATTCAGCATC
GTGTTCATCA AGGTTGGCTC AGTGATGATG GCGGAAAATC AGATGTTGCG GATGCTACGA CTAGTGGCAG TGCTTTGTTG
ATGGCAGAGA ATACGTGCGC TGAACTTCCA ATTGATGGTC TCGAGCAACT TCTGATGCAA ATATCGGATG ATCAACAGAC
AGTTGAAATG CTCTCTGGTT TCTCAGCATC CGTTCCCCAA TCGCAGCTTC AACATGATTA TCATCAGGGT TGTCTTGGTG
TTCATAGGGA GGAGGTTGGT GTTGCAGATT CTACCACTGT TAGTAGTGCT GTGGTGACAG AAGAATGTAC TGTCCGTGAG
CTTCAGGATA TTGAAGGGCT TCTGATGCAA ATAGAAAATG ACCAGGAAAA TGCCGAATCA CTGCCAGATT TCTCCACACC
AGTTCATCTC CATGATTGTC ATCAGGTTTG TCTTAATTTT GCACTTTATT TTGTACTAGT TCATCATGTA GAGTATGTGT
AATTTCTTCT GCATTTGTGC TCATACAATT TTTTCCAATC CAAGTTTTGA AAGACACAAT AATTTAGATG TCTAGTCCAC
ACCTTGGGAA CATGTTATGT TCCTAAAACC AAAAAAACAT CATCCTAGGG ATTGTAATTA TGCTGTTACA ATTTTATTGC
AATATGCTTA AGCTTTATTT GCTTGGACCT TACTCAGGCC GCCTTCGGAG ATTTTCAAGG AAGCCAGAGG GCTACATTCA
ACATTGCAAA TCTTTCTACT ATGGTGCAGG AAAGCCCAAA TTTTGATCTG CAAACTGGTC CAAGTAATCA AATTACTGAG
TCTATTCTCA CCACCGAGCC AATGAATGGA GAAACAAATG CTGTGGAAGA AACAAGTCCT CTGCGCTCTA TGTCAGTATT
GGGTAGTTAT GATAGGCAGG ATGGTGATGA TGAATTCCTT GAAATCAATG ATTTCTTCGA CCCAGAAGAT TTAGAACAGA
TTTTGGGCAG TACAAGAAGT CAGAACTTGA TTCCTGCTGA TGATGGAGTG TTTGATAGTT TGCAATACTC TGATGCTCCA
ATGTTTCTGC CTGGTTCATT TGACAGAACT GGTGTGGTGG CTGAAAACCA TTATGTTGAA TTTGGTGCTA GTGGAATTCA
GAACCAGGGA TTTCAGCATA CAACTGAATT ATTGGCACAT AATCAAGTCG CTCTAAATGT GCGGAACCAT ATGAAGGACA
ACCATGTTGT CTTCTCACAT TCATCAGGTG CTTAACAACG CCATTTCATT TACAAGCTTC TCTTATTATT ACCCAAAATT
ATTTCAGAAA CTATACTGTC CAACTTCTGA TTATTGTTTT CTCAATAAAA GGCAGCCAGC ATGCCTCCTC TTTGTATGAA
GATGAAGCAT AATGCTGCAG AGGGTCCCAA CTTCTAATTG AAACTACTAT TACTTCTGAA CATTGCAGAT GCTACCATTA
TTCATACAGT GAATGAGCAA CCGCCTAACC GGAGTTCAAA TGCTTCACAA TCATGGTTCA ATGGGGCTCT ATCTGCCTTG
CTCGATTCTG TTCCTAGCAG TCCAGCTATG GCTGCTGAAA ACATAGGTCT TAACAGAACA CTGCAACGCA TTTCGAGCTT
TAGGTCACAA CAACCTGCAA GAGAAGAAGT TAGCAGTACT CTTATCAACA CCAGAAGAAG AGGCGGTGGG CTAATTTTCA
TCTCGTTAAT GGTTTTACTT GTTGCTATCA TGTGGACCTT TAGCAATGGG TCTGCAGTCA AGCTTAGCAA GGGGTTATGG
AAGTTTCCCT CTACATAATA GGATGCACCC GGTTATCCTG GTGGCCAGTG CTTCTTACTA CTTCAAGTAC TAATTCTTGT
TTTGCTATCC TTTCCTCTAT TCCTTTACAT TGAAAAAGGC AACAATCTAG GAAAATATTA GAGGATTATG TGGTGTTAGC
ACTTACTTTC AGAATATTAT GCGAGAGATG TTAAAACAAA ACAAAATGAG AAAAAGAAAC ATCTGAGGTG AACTTCTGGA
TGTTTTTGTC CTCATCATTT TGATGAAAGT ATATATTGAA TGTAATTAAA CGATGATGGA TTGTTGAGAA GTGCAGTTGC
TGTGCACGAT AAATGAAAAA TCCATTTTTG TTGC

Locus: Os09g0493700

Loading...

Locus: Os09g0493700

Loading...