Os09t0497900-01

Locus

Os09g0497900

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC72

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 72

Oryzabase Gene Symbol Synonym(s)

ONAC072, ONAC72, DLN228, OsDLN228

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 072, NAC domain-containing protein 72, DLN repressor 228, DLN motif protein 228

Transcript Evidence

AK102511 (DDBJ, Best hit)

Protein Evidence

XP_002330817.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J033095I08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0497900-01)

RiceXPro (AK102511)

Others

Oryzabase (11496)

KEGG (Os09t0497900-01)

Transcript

1574 bp

>Os09t0497900-01 No apical meristem (NAM) protein domain containing protein.
AATTAATCCGATCAAAATTAAAGCCCAAAAGTTGAGATAGCTAGCTAGCTCATCAGGAGA
GAGTGAGAGACAATATCCAGCTTGCTAGGTAGCTAGCTGCCGTTTGCGTGTTCTTCTTTA
ATTTCTTCGTCGCATAATCTGTCTCGTCTCTGATAAACTTTTTATCTTCTTTTTTTGGGT
GGTCATGCATGCTGCGGCCAATTCGTTCTTGAATTCGTTAGCTACTCCATTCCATATATA
GATTCGATCTTGTCCTAGCTAGATACCTAGCTGCTGCTGCTGCTTCTTCTTCTTCCTTGG
TGTTGAATTTGGTTCAGCCGCTGCTAGCTATAGCTTTGCGCGGTGTTCGTAGGGTTAGGG
TTTTTGCTGTGTGTTCGACGATGGCTATGGGAatggaaggatcgggaggaggagggtcgg
cgaagaagaaagaggagagcttgccgccggggttcaggttccacccgacggacgaggagc
tcatcacctactacctgcggcagaagatcgccgacggcggcttcacggcgagggccatcg
ccgaggtcgatctcaacaagtgcgagccatgggatctcccagagaaggcaaaaatgggag
agaaggaatggtacttctttagcctaagggatcgaaagtacccaactggcgtgcgcacaa
accgagcaactaatgctggttattggaaaacaacgggaaaggataaggaaatcttcactg
gacaaccaccagcaacaccggagttagttggaatgaagaaaaccctagtgttctacaaag
gaagggctccaagaggtgagaaaaccaattgggtcatgcatgagtaccgactccactcca
aatcaatccccaaatcaaacaaggatgagtgggtcgtctgtcgcatatttgccaagactg
ccggcgtcaagaaatacccctccaacaatgctcattcccgatcccaccacccatacacac
tagacatggtcccacctctcctcccagctctattgcaacaagacccatttggtcgtggac
accacccttacatgaaccccgttgacatggcggaactctcccggtttgctagaggtacgc
cggggttgcacccacacatccaaccacaccccggttacatcaacccggctgcgcctttta
cactatcaggccttaacctcaaccttggatcctcgccagccatgcctccaccaccaccac
cgccaccacaatccatcctccaagcgatgtcgatgccgatgaaccaaccaagaagtacta
caaaccaggttatggtaacagagcaaatgattccaggactagccaatggtgtcatcccac
agggaacagatggaggttttaccacggatgttgttgttggaggcactggcatcagatacc
agaatttggatgtagagcagctggtggagaggtactggcctggtagttaccaaatgtagT
CCTGAAGGAAATGCTTGGGGTACTGCCAAGCAATTGTTGGTCTATTATGTAGGAAGACAT
AATTATTTGAGCTACCTTAATTTAGTCTATGGATATTGTATGATTACTTAGCTAATGTTG
TACCCTTGCTTTTT

CDS

1059 bp

>Os09t0497900-01 No apical meristem (NAM) protein domain containing protein.
ATGGCTATGGGAatggaaggatcgggaggaggagggtcggcgaagaagaaagaggagagc
ttgccgccggggttcaggttccacccgacggacgaggagctcatcacctactacctgcgg
cagaagatcgccgacggcggcttcacggcgagggccatcgccgaggtcgatctcaacaag
tgcgagccatgggatctcccagagaaggcaaaaatgggagagaaggaatggtacttcttt
agcctaagggatcgaaagtacccaactggcgtgcgcacaaaccgagcaactaatgctggt
tattggaaaacaacgggaaaggataaggaaatcttcactggacaaccaccagcaacaccg
gagttagttggaatgaagaaaaccctagtgttctacaaaggaagggctccaagaggtgag
aaaaccaattgggtcatgcatgagtaccgactccactccaaatcaatccccaaatcaaac
aaggatgagtgggtcgtctgtcgcatatttgccaagactgccggcgtcaagaaatacccc
tccaacaatgctcattcccgatcccaccacccatacacactagacatggtcccacctctc
ctcccagctctattgcaacaagacccatttggtcgtggacaccacccttacatgaacccc
gttgacatggcggaactctcccggtttgctagaggtacgccggggttgcacccacacatc
caaccacaccccggttacatcaacccggctgcgccttttacactatcaggccttaacctc
aaccttggatcctcgccagccatgcctccaccaccaccaccgccaccacaatccatcctc
caagcgatgtcgatgccgatgaaccaaccaagaagtactacaaaccaggttatggtaaca
gagcaaatgattccaggactagccaatggtgtcatcccacagggaacagatggaggtttt
accacggatgttgttgttggaggcactggcatcagataccagaatttggatgtagagcag
ctggtggagaggtactggcctggtagttaccaaatgtag

Protein

353 aa

>Os09t0497900-01 No apical meristem (NAM) protein domain containing protein.
MAMGMEGSGGGGSAKKKEESLPPGFRFHPTDEELITYYLRQKIADGGFTARAIAEVDLNK
CEPWDLPEKAKMGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIFTGQPPATP
ELVGMKKTLVFYKGRAPRGEKTNWVMHEYRLHSKSIPKSNKDEWVVCRIFAKTAGVKKYP
SNNAHSRSHHPYTLDMVPPLLPALLQQDPFGRGHHPYMNPVDMAELSRFARGTPGLHPHI
QPHPGYINPAAPFTLSGLNLNLGSSPAMPPPPPPPPQSILQAMSMPMNQPRSTTNQVMVT
EQMIPGLANGVIPQGTDGGFTTDVVVGGTGIRYQNLDVEQLVERYWPGSYQM*

5'UTR

chr09:19255575..19255954 (- strand) : 380 bp

CDS

chr09:19255373..19255574 (- strand) : 202 bp

chr09:19254120..19254400 (- strand) : 281 bp

chr09:19253422..19253997 (- strand) : 576 bp

3'UTR

chr09:19253287..19253421 (- strand) : 135 bp

FASTA

>Os09t0497900-01 class=Sequence position=chr09:19253287..19255954 (- strand)
AATTAATCCG ATCAAAATTA AAGCCCAAAA GTTGAGATAG CTAGCTAGCT CATCAGGAGA GAGTGAGAGA CAATATCCAG
CTTGCTAGGT AGCTAGCTGC CGTTTGCGTG TTCTTCTTTA ATTTCTTCGT CGCATAATCT GTCTCGTCTC TGATAAACTT
TTTATCTTCT TTTTTTGGGT GGTCATGCAT GCTGCGGCCA ATTCGTTCTT GAATTCGTTA GCTACTCCAT TCCATATATA
GATTCGATCT TGTCCTAGCT AGATACCTAG CTGCTGCTGC TGCTTCTTCT TCTTCCTTGG TGTTGAATTT GGTTCAGCCG
CTGCTAGCTA TAGCTTTGCG CGGTGTTCGT AGGGTTAGGG TTTTTGCTGT GTGTTCGACG ATGGCTATGG GAatggaagg
atcgggagga ggagggtcgg cgaagaagaa agaggagagc ttgccgccgg ggttcaggtt ccacccgacg gacgaggagc
tcatcaccta ctacctgcgg cagaagatcg ccgacggcgg cttcacggcg agggccatcg ccgaggtcga tctcaacaag
tgcgagccat gggatctccc aggtaatTAA TTAATTAATT AAACAAACAT GTGTTTGCAT GCATGATCTT GTGAAATTTT
ATATGCTCCT ACTTAATATC TCCCCTTCTC TGGCTCTCTC TCCTCGATCT TACTCACTTA GCTTGCTTTC GCTGTGGATT
AGCTTTTGTG TTCATATGAT CATATTGAAT AATTCATTTT TTTCCTGCAA TATATGAATA GTTTGTACTA CATATATTCA
GAAGTGCATG TTTGTTGTTG GCTATGCATG TATATGCATG CCTAGTCCTT TTTTCATGAT TTTGAGCATA TATTTCTTAC
CTATCCTTGC CCTGCCAGAG GTAATTAGTC GCGTCTAGAT TTCAAACATG CATATATGGT GCAAGTTTTT CAATAGCTAA
TCCAAAAGTC TAAGCTCTTA AAACTACTAC ATGTGTGATC CTAAAAGAAA ACTATGGGAT GGATTTCAAG TTTTCTATGG
TATTCCTTTT TTTTTTCCTT ACTGAGTCTT GCTTGCTTAA AACATGTGAA TATGATATCA TTGGTGATAT AATATCTTGG
TGGTACACAT GCATATATAA CATATTCAAT CCCCCTTCTC TCCCTTCCCT TCTATTAGTG TGAGTACGTA TATCTATAAT
CTATATTTGC ATCGTCTTTG TTCTCTTCTT TTTTAAAAAA AAACTTTCCT GCAAGAGTTG GTGGTTAATT TGGAACACAT
AAACTTCTTA TTGTTATTTC TAGGGGTCTT ATATTAGAAG CTATCTTAAT TCTATGTTCT TTATAAAAAA AAGTAAAATA
TCAACAGAAA TTACAAACCA AAGCTCTAGC TTCAGCACTG TATGTGCATA TGCATCGTCC TTACTCTCAT ATATATATGT
AGGAGATGTT TATGAGGTTC TGAATGTTCA AATATGTGGT CACATTTTTT CACACTTACA CATTCacaat ctatatgttc
tatgtattaa ttttctctaa taaatgtgct ccagagaagg caaaaatggg agagaaggaa tggtacttct ttagcctaag
ggatcgaaag tacccaactg gcgtgcgcac aaaccgagca actaatgctg gttattggaa aacaacggga aaggataagg
aaatcttcac tggacaacca ccagcaacac cggagttagt tggaatgaag aaaaccctag tgttctacaa aggaagggct
ccaagaggtg agaaaaccaa ttgggtcatg catgagtacc gactccactc caaatcaatc cccaaatcaa acaaggtaaa
caattcaatt gatagtattt tcaaactcac tactatacac atgcttcact aaatttactt gtattaattg aaatgttttt
gtgatgcatc attttgttta tactcattat atgacaggat gagtgggtcg tctgtcgcat atttgccaag actgccggcg
tcaagaaata cccctccaac aatgctcatt cccgatccca ccacccatac acactagaca tggtcccacc tctcctccca
gctctattgc aacaagaccc atttggtcgt ggacaccacc cttacatgaa ccccgttgac atggcggaac tctcccggtt
tgctagaggt acgccggggt tgcacccaca catccaacca caccccggtt acatcaaccc ggctgcgcct tttacactat
caggccttaa cctcaacctt ggatcctcgc cagccatgcc tccaccacca ccaccgccac cacaatccat cctccaagcg
atgtcgatgc cgatgaacca accaagaagt actacaaacc aggttatggt aacagagcaa atgattccag gactagccaa
tggtgtcatc ccacagggaa cagatggagg ttttaccacg gatgttgttg ttggaggcac tggcatcaga taccagaatt
tggatgtaga gcagctggtg gagaggtact ggcctggtag ttaccaaatg tagTCCTGAA GGAAATGCTT GGGGTACTGC
CAAGCAATTG TTGGTCTATT ATGTAGGAAG ACATAATTAT TTGAGCTACC TTAATTTAGT CTATGGATAT TGTATGATTA
CTTAGCTAAT GTTGTACCCT TGCTTTTT

Locus: Os09g0497900

Loading...

Locus: Os09g0497900

Loading...