Os09t0506000-01

Locus

Os09g0506000

Description

Nucleotide pyrophosphatase/phosphodiesterase

RAP-DB Gene Symbol Synonym(s)

PAP27A, OsPAP27a, NPP6, OsNPP6

RAP-DB Gene Name Synonym(s)

PURPLE ACID PHOSPHATASE 27A, purple acid phosphatase 27a, Nucleotide pyrophosphatase/phosphodiesterase 6

CGSNL Gene Symbol

PAP27A

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 27A

Oryzabase Gene Symbol Synonym(s)

OsPAP27a, NPP6, OsNPP6

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 27a, Nucleotide pyrophosphatase/phosphodiesterase 6

Transcript Evidence

AK106533

AK102346

Protein Evidence

Q0J0L3

Literature

PMID: 27335351

Note

Manual Curation

August 5, 2016

Gene Ontology (GO)

Molecular Function: acid phosphatase activity (GO:0003993)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Purple acid phosphatase-like, N-terminal (IPR008963)

Purple acid phosphatase, N-terminal (IPR015914)

Metallo-dependent phosphatase-like (IPR029052)

Calcineurin-like phosphoesterase domain, apaH type (IPR004843)

Iron/zinc purple acid phosphatase-like C-terminal domain (IPR025733)

Full-length cDNA

002-108-A11 (Online Clone Ordering)

J033091C10 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0506000-01)

Others

Oryzabase (11395)

Transcript

2322 bp

>Os09t0506000-01 Nucleotide pyrophosphatase/phosphodiesterase
ATCCGATCGGTTGACTCGCAACTGATCATGCGTAGTACCCCCCGAATATTCGGACGAGAT
GATCACATCATCACGCGTCCCCTAGAAAAACCCACTCCGCCGCCGCCGTCGTCGCGTCGC
ACGCGGCGCCCTAAAACAGCAGCCGCCGCGCCGGCCGCTCGCCACATTCACACGAGCGGG
GCCGGCCTCTCTCACGAGAGCAAACCAACAAACTAGTTCGGCGAGCGAGCTCGGTCAATC
GGGATACCGCCAAAGAGTGCGTGCGAGTGGCAATGGCGATGCCGCTGGGTGGGATTCTCC
TCCTCTTCCTCGTGCTCCTCGCCGCCGCCGCGGCGGGCGGCGGCGGCGGCGTGTGGGCGT
TCTCCTCGTCGTCGTCGTCGTCGTCGTATTCCAGGATCGGCGAGCAGCCGCTGTCGCTGA
TCGGCATCCACCGCGCGACGGTCGGCATCGACGCCGCGGCTTCCGTGCAAGCGTCGCCTC
GGCTTCTCGGTGTCAAGGGGGAAGATACTGCCTGGGTAACTGTTGATTTCGCAGCTCCGC
ATGCGAGTGACGGCGATTGGATCGGAGTATTCTCTCCTTCAAATTTCAACGCGTCCACAT
GCCCCGGTCCTTCTGGATCAGACTCAGGACCTGTTATATGCTCTGCACCAATAAAGTATC
AGCTTGCAAATTATTCTTCAGATTATGGCAAGACAGGAAAAGGCACTCTCAAGTTTCAGT
TGATCAATCAGAGGCAGGACTTCTCCTTTGCACTGTTCACTGGTGGTCTCTCAAATCCAA
AGCTTATCGCAGTATCAAATAAGATCGCCTTCGCAAACCCGAAAGCTCCGGTTTACCCTC
GTCTAGCTCAAGGCAAATCCTGGAATGAGATGACTGTCACATGGACTAGTGGTTATGACA
TCAAAGAGGCATATCCCTTTGTTGAATGGGGCATGAAATGGAGCCCTCCTACGCGCACAG
CAGCTGGCACCGTCACTTTTGATCGCGAAAGCTTATGCGGAGAACCTGCCCGTACTGTTG
GTTGGAGAGATCCAGGTTTCATACACACAGCATTCCTGACTGATTTATGGCCAAATAAAG
AATACTATTACAAGATTGGACATATGCTACCTGATGGAAAAATTGTATGGGGCAAATTTT
ACTCCTTCAAAGCACCTCCTTTTCCTGGGCAAAAGTCACTGCAGAGGGTTGTCATTTTTG
GTGATATGGGAAAGGCCGAGAGGGATGGAAGCAACGAGTACAGCAACTACCAGCCTGGAT
CACTGAACACAACTGACACACTGATCAAGGACCTTGACAACATCGACATTGTATTTCACA
TCGGTGACATTACCTATGCCAACGGGTACATTTCCCAGTGGGATCAGTTCACTCAGCAAG
TCGAGCCGATCACTGCTCGAGTCCCCTACATGATTGCAAGTGGAAACCATGAACGGGATT
GGCCAAACAGTGGATCTTTCTTCAATGGGACAGATTCTGGAGGGGAGTGTGGGGTGCTTG
CTGAGACCATGTACTACACACCCACAGAGAACAGGGCAAACTACTGgtacaagacggact
acgggatgttcagattctgcgtggcggacagcgagcacgactggcgggaaggcacggagc
agtacgcgttcatcgagagctgcctcgccacggtggaccggaagaagcagccatggctgg
tgttcatcgcgcaccgcgtcctcggctactcctcgggcttcttctacggcgccggcggcg
ccttcgcggagccgacggcaaggcagagcctccagaggctatggcagcggcaccgcgtcg
acctcgccttctacggCCACGTCCACAACTACGAGCGGACGTGCCCGGTCTACGACGGGC
GGTGCGCGTCGCCGGAGAGGTCGCGCTACTCCGGCGCGGTGGGCGGCACCATCCACGCGG
TGGTCGGCGGCGGCGGCAGCCACCTGAGCAACTTCACCGCCGAGGCGCCGCCGTGGAGCG
TGTACAGGGAGATGGACTACGGCTTCGTCAAGCTCACGGCGTTCAACTACACGTCGCTGC
TCTACGAGTACAGGCGGTCCAGCGACGGCGAGGTGCACGACAGCTTCACCGTCCACCGGG
AGTACCGCGACGTGCTCGCCTGCGTCGCCGACAGCTGCCCGCCGACCATCCCGCCGGCGA
CGTGATCCAGCTCCGGTGATTCCGCCGGCGAGTCTGCCGGCGACGTGTGCACTATTGCTG
CTTGGTGGTGCTTGCGGGCCTCGTCTGTAATCTTGACTTGTCAATCGTGTGTAAATTGAA
TTGCGAAATATTTCGAAATTAAGTCAAATAAAGAAATGTTAC

CDS

1893 bp

>Os09t0506000-01 Nucleotide pyrophosphatase/phosphodiesterase
ATGGCGATGCCGCTGGGTGGGATTCTCCTCCTCTTCCTCGTGCTCCTCGCCGCCGCCGCG
GCGGGCGGCGGCGGCGGCGTGTGGGCGTTCTCCTCGTCGTCGTCGTCGTCGTCGTATTCC
AGGATCGGCGAGCAGCCGCTGTCGCTGATCGGCATCCACCGCGCGACGGTCGGCATCGAC
GCCGCGGCTTCCGTGCAAGCGTCGCCTCGGCTTCTCGGTGTCAAGGGGGAAGATACTGCC
TGGGTAACTGTTGATTTCGCAGCTCCGCATGCGAGTGACGGCGATTGGATCGGAGTATTC
TCTCCTTCAAATTTCAACGCGTCCACATGCCCCGGTCCTTCTGGATCAGACTCAGGACCT
GTTATATGCTCTGCACCAATAAAGTATCAGCTTGCAAATTATTCTTCAGATTATGGCAAG
ACAGGAAAAGGCACTCTCAAGTTTCAGTTGATCAATCAGAGGCAGGACTTCTCCTTTGCA
CTGTTCACTGGTGGTCTCTCAAATCCAAAGCTTATCGCAGTATCAAATAAGATCGCCTTC
GCAAACCCGAAAGCTCCGGTTTACCCTCGTCTAGCTCAAGGCAAATCCTGGAATGAGATG
ACTGTCACATGGACTAGTGGTTATGACATCAAAGAGGCATATCCCTTTGTTGAATGGGGC
ATGAAATGGAGCCCTCCTACGCGCACAGCAGCTGGCACCGTCACTTTTGATCGCGAAAGC
TTATGCGGAGAACCTGCCCGTACTGTTGGTTGGAGAGATCCAGGTTTCATACACACAGCA
TTCCTGACTGATTTATGGCCAAATAAAGAATACTATTACAAGATTGGACATATGCTACCT
GATGGAAAAATTGTATGGGGCAAATTTTACTCCTTCAAAGCACCTCCTTTTCCTGGGCAA
AAGTCACTGCAGAGGGTTGTCATTTTTGGTGATATGGGAAAGGCCGAGAGGGATGGAAGC
AACGAGTACAGCAACTACCAGCCTGGATCACTGAACACAACTGACACACTGATCAAGGAC
CTTGACAACATCGACATTGTATTTCACATCGGTGACATTACCTATGCCAACGGGTACATT
TCCCAGTGGGATCAGTTCACTCAGCAAGTCGAGCCGATCACTGCTCGAGTCCCCTACATG
ATTGCAAGTGGAAACCATGAACGGGATTGGCCAAACAGTGGATCTTTCTTCAATGGGACA
GATTCTGGAGGGGAGTGTGGGGTGCTTGCTGAGACCATGTACTACACACCCACAGAGAAC
AGGGCAAACTACTGgtacaagacggactacgggatgttcagattctgcgtggcggacagc
gagcacgactggcgggaaggcacggagcagtacgcgttcatcgagagctgcctcgccacg
gtggaccggaagaagcagccatggctggtgttcatcgcgcaccgcgtcctcggctactcc
tcgggcttcttctacggcgccggcggcgccttcgcggagccgacggcaaggcagagcctc
cagaggctatggcagcggcaccgcgtcgacctcgccttctacggCCACGTCCACAACTAC
GAGCGGACGTGCCCGGTCTACGACGGGCGGTGCGCGTCGCCGGAGAGGTCGCGCTACTCC
GGCGCGGTGGGCGGCACCATCCACGCGGTGGTCGGCGGCGGCGGCAGCCACCTGAGCAAC
TTCACCGCCGAGGCGCCGCCGTGGAGCGTGTACAGGGAGATGGACTACGGCTTCGTCAAG
CTCACGGCGTTCAACTACACGTCGCTGCTCTACGAGTACAGGCGGTCCAGCGACGGCGAG
GTGCACGACAGCTTCACCGTCCACCGGGAGTACCGCGACGTGCTCGCCTGCGTCGCCGAC
AGCTGCCCGCCGACCATCCCGCCGGCGACGTGA

Protein

631 aa

>Os09t0506000-01 Nucleotide pyrophosphatase/phosphodiesterase
MAMPLGGILLLFLVLLAAAAAGGGGGVWAFSSSSSSSSYSRIGEQPLSLIGIHRATVGID
AAASVQASPRLLGVKGEDTAWVTVDFAAPHASDGDWIGVFSPSNFNASTCPGPSGSDSGP
VICSAPIKYQLANYSSDYGKTGKGTLKFQLINQRQDFSFALFTGGLSNPKLIAVSNKIAF
ANPKAPVYPRLAQGKSWNEMTVTWTSGYDIKEAYPFVEWGMKWSPPTRTAAGTVTFDRES
LCGEPARTVGWRDPGFIHTAFLTDLWPNKEYYYKIGHMLPDGKIVWGKFYSFKAPPFPGQ
KSLQRVVIFGDMGKAERDGSNEYSNYQPGSLNTTDTLIKDLDNIDIVFHIGDITYANGYI
SQWDQFTQQVEPITARVPYMIASGNHERDWPNSGSFFNGTDSGGECGVLAETMYYTPTEN
RANYWYKTDYGMFRFCVADSEHDWREGTEQYAFIESCLATVDRKKQPWLVFIAHRVLGYS
SGFFYGAGGAFAEPTARQSLQRLWQRHRVDLAFYGHVHNYERTCPVYDGRCASPERSRYS
GAVGGTIHAVVGGGGSHLSNFTAEAPPWSVYREMDYGFVKLTAFNYTSLLYEYRRSSDGE
VHDSFTVHREYRDVLACVADSCPPTIPPAT*

5'UTR

chr09:19585939..19586210 (- strand) : 272 bp

CDS

chr09:19585714..19585938 (- strand) : 225 bp

chr09:19584776..19584867 (- strand) : 92 bp

chr09:19584589..19584655 (- strand) : 67 bp

chr09:19584386..19584505 (- strand) : 120 bp

chr09:19584182..19584274 (- strand) : 93 bp

chr09:19583901..19584030 (- strand) : 130 bp

chr09:19583627..19583708 (- strand) : 82 bp

chr09:19583412..19583544 (- strand) : 133 bp

chr09:19583011..19583216 (- strand) : 206 bp

chr09:19582786..19582911 (- strand) : 126 bp

chr09:19581648..19582266 (- strand) : 619 bp

3'UTR

chr09:19581491..19581647 (- strand) : 157 bp

FASTA

>Os09t0506000-01 class=Sequence position=chr09:19581491..19586210 (- strand)
ATCCGATCGG TTGACTCGCA ACTGATCATG CGTAGTACCC CCCGAATATT CGGACGAGAT GATCACATCA TCACGCGTCC
CCTAGAAAAA CCCACTCCGC CGCCGCCGTC GTCGCGTCGC ACGCGGCGCC CTAAAACAGC AGCCGCCGCG CCGGCCGCTC
GCCACATTCA CACGAGCGGG GCCGGCCTCT CTCACGAGAG CAAACCAACA AACTAGTTCG GCGAGCGAGC TCGGTCAATC
GGGATACCGC CAAAGAGTGC GTGCGAGTGG CAATGGCGAT GCCGCTGGGT GGGATTCTCC TCCTCTTCCT CGTGCTCCTC
GCCGCCGCCG CGGCGGGCGG CGGCGGCGGC GTGTGGGCGT TCTCCTCGTC GTCGTCGTCG TCGTCGTATT CCAGGATCGG
CGAGCAGCCG CTGTCGCTGA TCGGCATCCA CCGCGCGACG GTCGGCATCG ACGCCGCGGC TTCCGTGCAA GCGTCGCCTC
GGCTTCTCGG TGTCAAGGTA GGTACACACT CGTCTCTTCG CCCTGCTCGC CGGAATCCCG AGCTCCGGCG GTGGTTCGCC
GGCCGGTTTC GTCTTAGCTC AGCTCGCCGT TGTGTTTGGC GCGGCGAGGA GAGACGACGA CGTGTTTGCG CGATGAACCG
TACAAAATTT GGATAGATAA GCCAATCGCC GTCGCCGTTG CAGTTCGGAA CGAAATCAAA TTTCTCAATA TCTCAAACAT
CTCCTAATGA TATCAATCGT TCTTCCTCTC GCCAGATTGG ATTTTCTTTT TTTTTTAAAA AAAATGGAGA AGATGATTAC
ATCACTAGCC TCTGCATGAG TCATGAACAA AAGCTGGGGA TCGGggccct gtttagattc caacattttt cttcaaactt
ctaacttttc tattacatcg aactttccta cacacataaa ttttcaactt tccgtcacat cgtccaattt cttcaaaatt
ccaattttAG TAGTGATGCC ATGTTTTTAG TGGCGAAATG TACCATGGAT ATTCTTCGAA ATTGATTGAT TGATTGATTG
GTGGATGGGT TTGAGTGTAT TGCCCATGCT TGTGCTAGAT TGCTAGTGTG GTCACAGGCC ACATGGAATT GCTTCCCACG
CCTGATAGGG TCAAATGGTA TTTGCTTCGA CTTTCCATTT GTCAGTGTAC GGTTTTGATG CACTACGATC TGCATGATTG
ATCCCATTTC GTTTTTATCT TAAATTATTG TTGCTCCTAT TGGTATTCGA TGTGATCGAA TCAAGATTTG TCTCCTCGTA
AAAAGAAAAT CAGGATTTCT TTGACCCATT TCCATTGTTT ATCTGACACT GTTGTGGATA CAGGGGGAAG ATACTGCCTG
GGTAACTGTT GATTTCGCAG CTCCGCATGC GAGTGACGGC GATTGGATCG GAGTATTCTC TCCTTCAAAT TTCAAGTATG
AAACAAGTAT ATTTGCCATG GATTTCAAAA TTTGAATAGT GAGACCATGT GATGTGAGTT TGTAGATTAC AATCACAATG
ACCATGATCT GATGAACTCT TGCACTTTCC TGCAGCGCGT CCACATGCCC CGGTCCTTCT GGATCAGACT CAGGACCTGT
TATATGCTCT GCACCAATAA AGGTTTGTAG GAATAATAGC ATCATGTTTG TAAAAGTTCT GCAAATGAAC TCCTAAACTG
ATTTTTTTTG TATGTCTGGT TTCAGTATCA GCTTGCAAAT TATTCTTCAG ATTATGGCAA GACAGGAAAA GGCACTCTCA
AGTTTCAGTT GATCAATCAG AGGCAGGACT TCTCCTTTGC ACTGTTCACT GGTGGTCTCT CAAATGTGAG TTCAAAACAT
CACATTGTAA TTTTTTTTTA GATAATTCAC ATTGTAATTT TATCCAGTCC TTATTACTAA AGAAATGGCA ACTGACTTAA
TGTATTTCAT TTCCAGCCAA AGCTTATCGC AGTATCAAAT AAGATCGCCT TCGCAAACCC GAAAGCTCCG GTTTACCCTC
GTCTAGCTCA AGGCAAATCC TGGAATGAGG TGAATTATCT TCTTCTCTCT GACTCACATT TGCAAATCAT CCTCTTCTCT
CTGACTCACA TTTGCAAATC TAGATATACA GATCTAATAT GAGATGCATC CTAGCTTAAA ACGTCAAATC TCTGAAGAAT
TTGTTGCTTT GTCTTGCTAG ATGACTGTCA CATGGACTAG TGGTTATGAC ATCAAAGAGG CATATCCCTT TGTTGAATGG
GGCATGAAAT GGAGCCCTCC TACGCGCACA GCAGCTGGCA CCGTCACTTT TGATCGCGAA AGCTTATGCG GTATGGACCG
TATAAAAGAT CCCTTTTATG CATTATCTTC TGTATATGCA TATAATAGCA TGAAATTTGT GAGGAGCTTG CAAAAATGTC
AAAATTACAC AATCCTAGAT GTCCAATCTT GATGCCCTGA TGTGGTTTAA ATTGTCTGAA GTTAGTACAT TGTGTTCCTC
ACAGTAGTTT TTGCTTGTGC AGGAGAACCT GCCCGTACTG TTGGTTGGAG AGATCCAGGT TTCATACACA CAGCATTCCT
GACTGATTTA TGGCCAAATA AAGAGTAAAT TACTTCCTAT GGCTCTATCA ACATTTTTTT TCAATTGTGA ATACTGGTCT
TCTGACTATG CCATTTTTCC TGCTAGATAC TATTACAAGA TTGGACATAT GCTACCTGAT GGAAAAATTG TATGGGGCAA
ATTTTACTCC TTCAAAGCAC CTCCTTTTCC TGGGCAAAAG TCACTGCAGA GGGTTGTCAT TTTTGGTGAT ATGGGAAAGG
TAAAATATAC ACCAGCGCAA AATGTATCGA TAGTTTTAGT ACTCTCTCCT TCAAAAATAA TTACTCCCTC TGGTCAAAAA
TATTTATCGT TTGGGACAAG ATTTAGTTAA ACTTTTAAGT TCACTGCTTA GCTCAGTCCT GAAGCAAAAC TACCTCATGT
TTCTTCTGAA TTCACATGGT TTTATCACTT GCAGGCCGAG AGGGATGGAA GCAACGAGTA CAGCAACTAC CAGCCTGGAT
CACTGAACAC AACTGACACA CTGATCAAGG ACCTTGACAA CATCGACATT GTATTTCACA TCGGTGACAT TACCTATGCC
AACGGGTACA TTTCCCAGTG GGATCAGTTC ACTCAGCAAG TCGAGCCGAT CACTGCTCGA GTCCCCTACA TGATTGCAAG
GTCTTTCTTG ATGAACATCT TTGGTTTATT AAATCTCCAA GCCGGTTAAC TAATTCTATG ATAATTACTA ACATGTTTGA
TACGATTGGT TTGATTCAGT GGAAACCATG AACGGGATTG GCCAAACAGT GGATCTTTCT TCAATGGGAC AGATTCTGGA
GGGGAGTGTG GGGTGCTTGC TGAGACCATG TACTACACAC CCACAGAGAA CAGGGCAAAC TACTGGTAAG TCTCAGACTC
TCTCTGTATA TATAATCAAC TCAAATTTCA ATTTCCATTT TTTTAAAAAA AAATTGAATA CGTTTGTACT GAATTTTGAA
TATTTTTTTC TAAATTTTAG TTGGAGGCAC ATTCTTAGTT TATAAAACCA ACAGAAAAGG CATTTTTGTT TTTGAAAACC
GGATGTTTCG AGTAAGGTCG AGATCACAAA CTGGCTCGGT GATGCTCAAA AAGTTCAAAC TAAATCTGAA TTTTGTTGGC
AAAATTTGGT CAAATTTCAT CGGTAGTCAA CGGATTTCAT GAAAAAAAAA TAGGGGAAAC CGTTTCAGAA AGCAGTTCAG
TTTTGCGGAC TCTGCACGTC CTACTGGGAT CCACCGACCT GAAATTTTCA TTCCGAAATT GTGAACCCTG CTGTCAACTG
GTTGCCATTG TAGACCGGAA TGCCTGAATT TTGAACAAAC AATCTTTTAT TTTTTTTGCT AAAATTTAAA ATATTCGAAA
TTTGTTCTGA ACTTTGTTGG GCaggtacaa gacggactac gggatgttca gattctgcgt ggcggacagc gagcacgact
ggcgggaagg cacggagcag tacgcgttca tcgagagctg cctcgccacg gtggaccgga agaagcagcc atggctggtg
ttcatcgcgc accgcgtcct cggctactcc tcgggcttct tctacggcgc cggcggcgcc ttcgcggagc cgacggcaag
gcagagcctc cagaggctat ggcagcggca ccgcgtcgac ctcgccttct acggCCACGT CCACAACTAC GAGCGGACGT
GCCCGGTCTA CGACGGGCGG TGCGCGTCGC CGGAGAGGTC GCGCTACTCC GGCGCGGTGG GCGGCACCAT CCACGCGGTG
GTCGGCGGCG GCGGCAGCCA CCTGAGCAAC TTCACCGCCG AGGCGCCGCC GTGGAGCGTG TACAGGGAGA TGGACTACGG
CTTCGTCAAG CTCACGGCGT TCAACTACAC GTCGCTGCTC TACGAGTACA GGCGGTCCAG CGACGGCGAG GTGCACGACA
GCTTCACCGT CCACCGGGAG TACCGCGACG TGCTCGCCTG CGTCGCCGAC AGCTGCCCGC CGACCATCCC GCCGGCGACG
TGATCCAGCT CCGGTGATTC CGCCGGCGAG TCTGCCGGCG ACGTGTGCAC TATTGCTGCT TGGTGGTGCT TGCGGGCCTC
GTCTGTAATC TTGACTTGTC AATCGTGTGT AAATTGAATT GCGAAATATT TCGAAATTAA GTCAAATAAA GAAATGTTAC

Locus: Os09g0506000

Loading...

Locus: Os09g0506000

Loading...