Os09t0506000-02

Locus

Os09g0506000

Description

Similar to Nucleotide pyrophosphatase/phosphodiesterase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAP27A

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 27A

Oryzabase Gene Symbol Synonym(s)

OsPAP27a, NPP6, OsNPP6

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 27a, Nucleotide pyrophosphatase/phosphodiesterase 6

Transcript Evidence

AK073281 (DDBJ, Best hit)

Protein Evidence

B6SWL1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid phosphatase activity (GO:0003993)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Purple acid phosphatase-like, N-terminal (IPR008963)

Purple acid phosphatase, N-terminal (IPR015914)

Full-length cDNA

J033028M10 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0506000-02)

RiceXPro (AK073281)

Others

Oryzabase (11395)

KEGG (Os09t0506000-02)

Transcript

1517 bp

>Os09t0506000-02 Similar to Nucleotide pyrophosphatase/phosphodiesterase.
ATCGGGATACCGCCAAAGAGTGCGTGCGAGTGGCAATGGCGATGCCGCTGGGTGGGATTC
TCCTCCTCTTCCTCGTGCTCCTCGCCGCCGCCGCGGCGGGCGGCGGCGGCGGCGTGTGGG
CGTTCTCCTCGTCGTCGTCGTCGTCGTCGTATTCCAGGATCGGCGAGCAGCCGCTGTCGC
TGATCGGCATCCACCGCGCGACGGTCGGCATCGACGCCGCGGCTTCCGTGCAAGCGTCGC
CTCGGCTTCTCGGTGTCAAGGGGGAAGATACTGCCTGGGTAACTGTTGATTTCGCAGCTC
CGCATGCGAGTGACGGCGATTGGATCGGAGTATTCTCTCCTTCAAATTTCAACGCGTCCA
CATGCCCCGGTCCTTCTGGATCAGACTCAGGACCTGTTATATGCTCTGCACCAATAAAGT
ATCAGCTTGCAAATTATTCTTCAGATTATGGCAAGACAGGAAAAGGCACTCTCAAGTTTC
AGTTGATCAATCAGAGGCAGGACTTCTCCTTTGCACTGTTCACTGGTGGTCTCTCAAATC
CAAAGCTTATCGCAGTATCAAATAAGATCGCCTTCGCAAACCCGAAAGCTCCGGTTTACC
CTCGTCTAGCTCAAGGCAAATCCTGGAATGAGATGACTGTCACATGGACTAGTGGTTATG
ACATCAAAGAGGCATATCCCTTTGTTGAATGGGGCATGAAATGGAGCCCTCCTACGCGCA
CAGCAGCTGGCACCGTCACTTTTGATCGCGAAAGCTTATGCGGAGAACCTGCCCGTACTG
TTGGTTGGAGAGATCCAGGTTTCATACACACAGCATTCCTGACTGATTTATGGCCAAATA
AAGAATACTATTACAAGATTGGACATATGCTACCTGATGGAAAAATTGTATGGGGCAAAT
TTTACTCCTTCAAAGCACCTCCTTTTCCTGGGCAAAAGTCACTGCAGAGGGTTGTCATTT
TTGGTGATATGGGAAAGGCCGAGAGGGATGGAAGCAACGAGTACAGCAACTACCAGCCTG
GATCACTGAACACAACTGACACACTGATCAAGGACCTTGACAACATCGACATTGTATTTC
ACATCGGTGACATTACCTATGCCAACGGGTACATTTCCCAGTGGGATCAGTTCACTCAGC
AAGTCGAGCCGATCACTGCTCGAGTCCCCTACATGATTGCAAGTGGAAACCATGAACGGG
ATTGGCCAAACAGTGGATCTTTCTTCAATGGGACAGATTCTGGAGGGGAGTGTGGGGTGC
TTGCTGAGACCATGTACTACACACCCACAGAGAACAGGGCAAACTACTGgtacaagacgg
actacgggatgttcagattctgcgtggcggacagcgagcacgactggcgggaaggcacgg
agcagtacgcgttcatcgagagctgcctcgccacggtggaccggaagaagcagccatggc
tggtgttcatcgcgcaccgcgtcctcggctactcctcgggcttcttctacggcgccggcg
gcgccttcgcggagccg

CDS

1482 bp

>Os09t0506000-02 Similar to Nucleotide pyrophosphatase/phosphodiesterase.
ATGGCGATGCCGCTGGGTGGGATTCTCCTCCTCTTCCTCGTGCTCCTCGCCGCCGCCGCG
GCGGGCGGCGGCGGCGGCGTGTGGGCGTTCTCCTCGTCGTCGTCGTCGTCGTCGTATTCC
AGGATCGGCGAGCAGCCGCTGTCGCTGATCGGCATCCACCGCGCGACGGTCGGCATCGAC
GCCGCGGCTTCCGTGCAAGCGTCGCCTCGGCTTCTCGGTGTCAAGGGGGAAGATACTGCC
TGGGTAACTGTTGATTTCGCAGCTCCGCATGCGAGTGACGGCGATTGGATCGGAGTATTC
TCTCCTTCAAATTTCAACGCGTCCACATGCCCCGGTCCTTCTGGATCAGACTCAGGACCT
GTTATATGCTCTGCACCAATAAAGTATCAGCTTGCAAATTATTCTTCAGATTATGGCAAG
ACAGGAAAAGGCACTCTCAAGTTTCAGTTGATCAATCAGAGGCAGGACTTCTCCTTTGCA
CTGTTCACTGGTGGTCTCTCAAATCCAAAGCTTATCGCAGTATCAAATAAGATCGCCTTC
GCAAACCCGAAAGCTCCGGTTTACCCTCGTCTAGCTCAAGGCAAATCCTGGAATGAGATG
ACTGTCACATGGACTAGTGGTTATGACATCAAAGAGGCATATCCCTTTGTTGAATGGGGC
ATGAAATGGAGCCCTCCTACGCGCACAGCAGCTGGCACCGTCACTTTTGATCGCGAAAGC
TTATGCGGAGAACCTGCCCGTACTGTTGGTTGGAGAGATCCAGGTTTCATACACACAGCA
TTCCTGACTGATTTATGGCCAAATAAAGAATACTATTACAAGATTGGACATATGCTACCT
GATGGAAAAATTGTATGGGGCAAATTTTACTCCTTCAAAGCACCTCCTTTTCCTGGGCAA
AAGTCACTGCAGAGGGTTGTCATTTTTGGTGATATGGGAAAGGCCGAGAGGGATGGAAGC
AACGAGTACAGCAACTACCAGCCTGGATCACTGAACACAACTGACACACTGATCAAGGAC
CTTGACAACATCGACATTGTATTTCACATCGGTGACATTACCTATGCCAACGGGTACATT
TCCCAGTGGGATCAGTTCACTCAGCAAGTCGAGCCGATCACTGCTCGAGTCCCCTACATG
ATTGCAAGTGGAAACCATGAACGGGATTGGCCAAACAGTGGATCTTTCTTCAATGGGACA
GATTCTGGAGGGGAGTGTGGGGTGCTTGCTGAGACCATGTACTACACACCCACAGAGAAC
AGGGCAAACTACTGgtacaagacggactacgggatgttcagattctgcgtggcggacagc
gagcacgactggcgggaaggcacggagcagtacgcgttcatcgagagctgcctcgccacg
gtggaccggaagaagcagccatggctggtgttcatcgcgcaccgcgtcctcggctactcc
tcgggcttcttctacggcgccggcggcgccttcgcggagccg

Protein

494 aa

>Os09t0506000-02 Similar to Nucleotide pyrophosphatase/phosphodiesterase.
MAMPLGGILLLFLVLLAAAAAGGGGGVWAFSSSSSSSSYSRIGEQPLSLIGIHRATVGID
AAASVQASPRLLGVKGEDTAWVTVDFAAPHASDGDWIGVFSPSNFNASTCPGPSGSDSGP
VICSAPIKYQLANYSSDYGKTGKGTLKFQLINQRQDFSFALFTGGLSNPKLIAVSNKIAF
ANPKAPVYPRLAQGKSWNEMTVTWTSGYDIKEAYPFVEWGMKWSPPTRTAAGTVTFDRES
LCGEPARTVGWRDPGFIHTAFLTDLWPNKEYYYKIGHMLPDGKIVWGKFYSFKAPPFPGQ
KSLQRVVIFGDMGKAERDGSNEYSNYQPGSLNTTDTLIKDLDNIDIVFHIGDITYANGYI
SQWDQFTQQVEPITARVPYMIASGNHERDWPNSGSFFNGTDSGGECGVLAETMYYTPTEN
RANYWYKTDYGMFRFCVADSEHDWREGTEQYAFIESCLATVDRKKQPWLVFIAHRVLGYS
SGFFYGAGGAFAEP

5'UTR

chr09:19585939..19585973 (- strand) : 35 bp

CDS

chr09:19585714..19585938 (- strand) : 225 bp

chr09:19584776..19584867 (- strand) : 92 bp

chr09:19584589..19584655 (- strand) : 67 bp

chr09:19584386..19584505 (- strand) : 120 bp

chr09:19584182..19584274 (- strand) : 93 bp

chr09:19583901..19584030 (- strand) : 130 bp

chr09:19583627..19583708 (- strand) : 82 bp

chr09:19583412..19583544 (- strand) : 133 bp

chr09:19583011..19583216 (- strand) : 206 bp

chr09:19582786..19582911 (- strand) : 126 bp

chr09:19582059..19582266 (- strand) : 208 bp

FASTA

>Os09t0506000-02 class=Sequence position=chr09:19582059..19585973 (- strand)
ATCGGGATAC CGCCAAAGAG TGCGTGCGAG TGGCAATGGC GATGCCGCTG GGTGGGATTC TCCTCCTCTT CCTCGTGCTC
CTCGCCGCCG CCGCGGCGGG CGGCGGCGGC GGCGTGTGGG CGTTCTCCTC GTCGTCGTCG TCGTCGTCGT ATTCCAGGAT
CGGCGAGCAG CCGCTGTCGC TGATCGGCAT CCACCGCGCG ACGGTCGGCA TCGACGCCGC GGCTTCCGTG CAAGCGTCGC
CTCGGCTTCT CGGTGTCAAG GTAGGTACAC ACTCGTCTCT TCGCCCTGCT CGCCGGAATC CCGAGCTCCG GCGGTGGTTC
GCCGGCCGGT TTCGTCTTAG CTCAGCTCGC CGTTGTGTTT GGCGCGGCGA GGAGAGACGA CGACGTGTTT GCGCGATGAA
CCGTACAAAA TTTGGATAGA TAAGCCAATC GCCGTCGCCG TTGCAGTTCG GAACGAAATC AAATTTCTCA ATATCTCAAA
CATCTCCTAA TGATATCAAT CGTTCTTCCT CTCGCCAGAT TGGATTTTCT TTTTTTTTTA AAAAAAATGG AGAAGATGAT
TACATCACTA GCCTCTGCAT GAGTCATGAA CAAAAGCTGG GGATCGGggc cctgtttaga ttccaacatt tttcttcaaa
cttctaactt ttctattaca tcgaactttc ctacacacat aaattttcaa ctttccgtca catcgtccaa tttcttcaaa
attccaattt tAGTAGTGAT GCCATGTTTT TAGTGGCGAA ATGTACCATG GATATTCTTC GAAATTGATT GATTGATTGA
TTGGTGGATG GGTTTGAGTG TATTGCCCAT GCTTGTGCTA GATTGCTAGT GTGGTCACAG GCCACATGGA ATTGCTTCCC
ACGCCTGATA GGGTCAAATG GTATTTGCTT CGACTTTCCA TTTGTCAGTG TACGGTTTTG ATGCACTACG ATCTGCATGA
TTGATCCCAT TTCGTTTTTA TCTTAAATTA TTGTTGCTCC TATTGGTATT CGATGTGATC GAATCAAGAT TTGTCTCCTC
GTAAAAAGAA AATCAGGATT TCTTTGACCC ATTTCCATTG TTTATCTGAC ACTGTTGTGG ATACAGGGGG AAGATACTGC
CTGGGTAACT GTTGATTTCG CAGCTCCGCA TGCGAGTGAC GGCGATTGGA TCGGAGTATT CTCTCCTTCA AATTTCAAGT
ATGAAACAAG TATATTTGCC ATGGATTTCA AAATTTGAAT AGTGAGACCA TGTGATGTGA GTTTGTAGAT TACAATCACA
ATGACCATGA TCTGATGAAC TCTTGCACTT TCCTGCAGCG CGTCCACATG CCCCGGTCCT TCTGGATCAG ACTCAGGACC
TGTTATATGC TCTGCACCAA TAAAGGTTTG TAGGAATAAT AGCATCATGT TTGTAAAAGT TCTGCAAATG AACTCCTAAA
CTGATTTTTT TTGTATGTCT GGTTTCAGTA TCAGCTTGCA AATTATTCTT CAGATTATGG CAAGACAGGA AAAGGCACTC
TCAAGTTTCA GTTGATCAAT CAGAGGCAGG ACTTCTCCTT TGCACTGTTC ACTGGTGGTC TCTCAAATGT GAGTTCAAAA
CATCACATTG TAATTTTTTT TTAGATAATT CACATTGTAA TTTTATCCAG TCCTTATTAC TAAAGAAATG GCAACTGACT
TAATGTATTT CATTTCCAGC CAAAGCTTAT CGCAGTATCA AATAAGATCG CCTTCGCAAA CCCGAAAGCT CCGGTTTACC
CTCGTCTAGC TCAAGGCAAA TCCTGGAATG AGGTGAATTA TCTTCTTCTC TCTGACTCAC ATTTGCAAAT CATCCTCTTC
TCTCTGACTC ACATTTGCAA ATCTAGATAT ACAGATCTAA TATGAGATGC ATCCTAGCTT AAAACGTCAA ATCTCTGAAG
AATTTGTTGC TTTGTCTTGC TAGATGACTG TCACATGGAC TAGTGGTTAT GACATCAAAG AGGCATATCC CTTTGTTGAA
TGGGGCATGA AATGGAGCCC TCCTACGCGC ACAGCAGCTG GCACCGTCAC TTTTGATCGC GAAAGCTTAT GCGGTATGGA
CCGTATAAAA GATCCCTTTT ATGCATTATC TTCTGTATAT GCATATAATA GCATGAAATT TGTGAGGAGC TTGCAAAAAT
GTCAAAATTA CACAATCCTA GATGTCCAAT CTTGATGCCC TGATGTGGTT TAAATTGTCT GAAGTTAGTA CATTGTGTTC
CTCACAGTAG TTTTTGCTTG TGCAGGAGAA CCTGCCCGTA CTGTTGGTTG GAGAGATCCA GGTTTCATAC ACACAGCATT
CCTGACTGAT TTATGGCCAA ATAAAGAGTA AATTACTTCC TATGGCTCTA TCAACATTTT TTTTCAATTG TGAATACTGG
TCTTCTGACT ATGCCATTTT TCCTGCTAGA TACTATTACA AGATTGGACA TATGCTACCT GATGGAAAAA TTGTATGGGG
CAAATTTTAC TCCTTCAAAG CACCTCCTTT TCCTGGGCAA AAGTCACTGC AGAGGGTTGT CATTTTTGGT GATATGGGAA
AGGTAAAATA TACACCAGCG CAAAATGTAT CGATAGTTTT AGTACTCTCT CCTTCAAAAA TAATTACTCC CTCTGGTCAA
AAATATTTAT CGTTTGGGAC AAGATTTAGT TAAACTTTTA AGTTCACTGC TTAGCTCAGT CCTGAAGCAA AACTACCTCA
TGTTTCTTCT GAATTCACAT GGTTTTATCA CTTGCAGGCC GAGAGGGATG GAAGCAACGA GTACAGCAAC TACCAGCCTG
GATCACTGAA CACAACTGAC ACACTGATCA AGGACCTTGA CAACATCGAC ATTGTATTTC ACATCGGTGA CATTACCTAT
GCCAACGGGT ACATTTCCCA GTGGGATCAG TTCACTCAGC AAGTCGAGCC GATCACTGCT CGAGTCCCCT ACATGATTGC
AAGGTCTTTC TTGATGAACA TCTTTGGTTT ATTAAATCTC CAAGCCGGTT AACTAATTCT ATGATAATTA CTAACATGTT
TGATACGATT GGTTTGATTC AGTGGAAACC ATGAACGGGA TTGGCCAAAC AGTGGATCTT TCTTCAATGG GACAGATTCT
GGAGGGGAGT GTGGGGTGCT TGCTGAGACC ATGTACTACA CACCCACAGA GAACAGGGCA AACTACTGGT AAGTCTCAGA
CTCTCTCTGT ATATATAATC AACTCAAATT TCAATTTCCA TTTTTTTAAA AAAAAATTGA ATACGTTTGT ACTGAATTTT
GAATATTTTT TTCTAAATTT TAGTTGGAGG CACATTCTTA GTTTATAAAA CCAACAGAAA AGGCATTTTT GTTTTTGAAA
ACCGGATGTT TCGAGTAAGG TCGAGATCAC AAACTGGCTC GGTGATGCTC AAAAAGTTCA AACTAAATCT GAATTTTGTT
GGCAAAATTT GGTCAAATTT CATCGGTAGT CAACGGATTT CATGAAAAAA AAATAGGGGA AACCGTTTCA GAAAGCAGTT
CAGTTTTGCG GACTCTGCAC GTCCTACTGG GATCCACCGA CCTGAAATTT TCATTCCGAA ATTGTGAACC CTGCTGTCAA
CTGGTTGCCA TTGTAGACCG GAATGCCTGA ATTTTGAACA AACAATCTTT TATTTTTTTT GCTAAAATTT AAAATATTCG
AAATTTGTTC TGAACTTTGT TGGGCaggta caagacggac tacgggatgt tcagattctg cgtggcggac agcgagcacg
actggcggga aggcacggag cagtacgcgt tcatcgagag ctgcctcgcc acggtggacc ggaagaagca gccatggctg
gtgttcatcg cgcaccgcgt cctcggctac tcctcgggct tcttctacgg cgccggcggc gccttcgcgg agccg

Locus: Os09g0506000

Loading...

Locus: Os09g0506000

Loading...