Os09t0506000-03

Locus

Os09g0506000

Description

Similar to Nucleotide pyrophosphatase/phosphodiesterase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAP27A

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 27A

Oryzabase Gene Symbol Synonym(s)

OsPAP27a, NPP6, OsNPP6

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 27a, Nucleotide pyrophosphatase/phosphodiesterase 6

Transcript Evidence

AK073291 (DDBJ, Best hit)

Protein Evidence

B6SWL1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid phosphatase activity (GO:0003993)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Purple acid phosphatase-like, N-terminal (IPR008963)

Purple acid phosphatase, N-terminal (IPR015914)

Full-length cDNA

J033024B14 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0506000-03)

RiceXPro (AK073291)

Others

Oryzabase (11395)

KEGG (Os09t0506000-03)

Transcript

1825 bp

>Os09t0506000-03 Similar to Nucleotide pyrophosphatase/phosphodiesterase.
AGGGGGAAGATACTGCCTGGGTAACTGTTGATTTCGCAGCTCCGCATGCGAGTGACGGCG
ATTGGATCGGAGTATTCTCTCCTTCAAATTTCAACGCGTCCACATGCCCCGGTCCTTCTG
GATCAGACTCAGGACCTGTTATATGCTCTGCACCAATAAAGTATCAGCTTGCAAATTATT
CTTCAGATTATGGCAAGACAGGAAAAGGCACTCTCAAGTTTCAGTTGATCAATCAGAGGC
AGGACTTCTCCTTTGCACTGTTCACTGGTGGTCTCTCAAATCCAAAGCTTATCGCAGTAT
CAAATAAGATCGCCTTCGCAAACCCGAAAGCTCCGGTTTACCCTCGTCTAGCTCAAGGCA
AATCCTGGAATGAGATGACTGTCACATGGACTAGTGGTTATGACATCAAAGAGGCATATC
CCTTTGTTGAATGGGGCATGAAATGGAGCCCTCCTACGCGCACAGCAGCTGGCACCGTCA
CTTTTGATCGCGAAAGCTTATGCGGAGAACCTGCCCGTACTGTTGGTTGGAGAGATCCAG
GTTTCATACACACAGCATTCCTGACTGATTTATGGCCAAATAAAGAATACTATTACAAGA
TTGGACATATGCTACCTGATGGAAAAATTGTATGGGGCAAATTTTACTCCTTCAAAGCAC
CTCCTTTTCCTGGGCAAAAGTCACTGCAGAGGGTTGTCATTTTTGGTGATATGGGAAAGG
CCGAGAGGGATGGAAGCAACGAGTACAGCAACTACCAGCCTGGATCACTGAACACAACTG
ACACACTGATCAAGGACCTTGACAACATCGACATTGTATTTCACATCGGTGACATTACCT
ATGCCAACGGGTACATTTCCCAGTGGGATCAGTTCACTCAGCAAGTCGAGCCGATCACTG
CTCGAGTCCCCTACATGATTGCAAGTGGAAACCATGAACGGGATTGGCCAAACAGTGGAT
CTTTCTTCAATGGGACAGATTCTGGAGGGGAGTGTGGGGTGCTTGCTGAGACCATGTACT
ACACACCCACAGAGAACAGGGCAAACTACTGgtacaagacggactacgggatgttcagat
tctgcgtggcggacagcgagcacgactggcgggaaggcacggagcagtacgcgttcatcg
agagctgcctcgccacggtggaccggaagaagcagccatggctggtgttcatcgcgcacc
gcgtcctcggctactcctcgggcttcttctacggcgccggcggcgccttcgcggagccga
cggcaaggcagagcctccagaggctatggcagcggcaccgcgtcgacctcgccttctacg
gCCACGTCCACAACTACGAGCGGACGTGCCCGGTCTACGACGGGCGGTGCGCGTCGCCGG
AGAGGTCGCGCTACTCCGGCGCGGTGGGCGGCACCATCCACGCGGTGGTCGGCGGCGGCG
GCAGCCACCTGAGCAACTTCACCGCCGAGGCGCCGCCGTGGAGCGTGTACAGGGAGATGG
ACTACGGCTTCGTCAAGCTCACGGCGTTCAACTACACGTCGCTGCTCTACGAGTACAGGC
GGTCCAGCGACGGCGAGGTGCACGACAGCTTCACCGTCCACCGGGAGTACCGCGACGTGC
TCGCCTGCGTCGCCGACAGCTGCCCGCCGACCATCCCGCCGGCGACGTGATCCAGCTCCG
GTGATTCCGCCGGCGAGTCTGCCGGCGACGTGTGCACTATTGCTGCTTGGTGGTGCTTGC
GGGCCTCGTCTGTAATCTTGACTTGTCAATCGTGTGTAAATTGAATTGCGAAATATTTCG
AAATTAAGTCAAATAAAGAAATGTT

CDS

1668 bp

>Os09t0506000-03 Similar to Nucleotide pyrophosphatase/phosphodiesterase.
GGGGAAGATACTGCCTGGGTAACTGTTGATTTCGCAGCTCCGCATGCGAGTGACGGCGAT
TGGATCGGAGTATTCTCTCCTTCAAATTTCAACGCGTCCACATGCCCCGGTCCTTCTGGA
TCAGACTCAGGACCTGTTATATGCTCTGCACCAATAAAGTATCAGCTTGCAAATTATTCT
TCAGATTATGGCAAGACAGGAAAAGGCACTCTCAAGTTTCAGTTGATCAATCAGAGGCAG
GACTTCTCCTTTGCACTGTTCACTGGTGGTCTCTCAAATCCAAAGCTTATCGCAGTATCA
AATAAGATCGCCTTCGCAAACCCGAAAGCTCCGGTTTACCCTCGTCTAGCTCAAGGCAAA
TCCTGGAATGAGATGACTGTCACATGGACTAGTGGTTATGACATCAAAGAGGCATATCCC
TTTGTTGAATGGGGCATGAAATGGAGCCCTCCTACGCGCACAGCAGCTGGCACCGTCACT
TTTGATCGCGAAAGCTTATGCGGAGAACCTGCCCGTACTGTTGGTTGGAGAGATCCAGGT
TTCATACACACAGCATTCCTGACTGATTTATGGCCAAATAAAGAATACTATTACAAGATT
GGACATATGCTACCTGATGGAAAAATTGTATGGGGCAAATTTTACTCCTTCAAAGCACCT
CCTTTTCCTGGGCAAAAGTCACTGCAGAGGGTTGTCATTTTTGGTGATATGGGAAAGGCC
GAGAGGGATGGAAGCAACGAGTACAGCAACTACCAGCCTGGATCACTGAACACAACTGAC
ACACTGATCAAGGACCTTGACAACATCGACATTGTATTTCACATCGGTGACATTACCTAT
GCCAACGGGTACATTTCCCAGTGGGATCAGTTCACTCAGCAAGTCGAGCCGATCACTGCT
CGAGTCCCCTACATGATTGCAAGTGGAAACCATGAACGGGATTGGCCAAACAGTGGATCT
TTCTTCAATGGGACAGATTCTGGAGGGGAGTGTGGGGTGCTTGCTGAGACCATGTACTAC
ACACCCACAGAGAACAGGGCAAACTACTGgtacaagacggactacgggatgttcagattc
tgcgtggcggacagcgagcacgactggcgggaaggcacggagcagtacgcgttcatcgag
agctgcctcgccacggtggaccggaagaagcagccatggctggtgttcatcgcgcaccgc
gtcctcggctactcctcgggcttcttctacggcgccggcggcgccttcgcggagccgacg
gcaaggcagagcctccagaggctatggcagcggcaccgcgtcgacctcgccttctacggC
CACGTCCACAACTACGAGCGGACGTGCCCGGTCTACGACGGGCGGTGCGCGTCGCCGGAG
AGGTCGCGCTACTCCGGCGCGGTGGGCGGCACCATCCACGCGGTGGTCGGCGGCGGCGGC
AGCCACCTGAGCAACTTCACCGCCGAGGCGCCGCCGTGGAGCGTGTACAGGGAGATGGAC
TACGGCTTCGTCAAGCTCACGGCGTTCAACTACACGTCGCTGCTCTACGAGTACAGGCGG
TCCAGCGACGGCGAGGTGCACGACAGCTTCACCGTCCACCGGGAGTACCGCGACGTGCTC
GCCTGCGTCGCCGACAGCTGCCCGCCGACCATCCCGCCGGCGACGTGA

Protein

556 aa

>Os09t0506000-03 Similar to Nucleotide pyrophosphatase/phosphodiesterase.
GEDTAWVTVDFAAPHASDGDWIGVFSPSNFNASTCPGPSGSDSGPVICSAPIKYQLANYS
SDYGKTGKGTLKFQLINQRQDFSFALFTGGLSNPKLIAVSNKIAFANPKAPVYPRLAQGK
SWNEMTVTWTSGYDIKEAYPFVEWGMKWSPPTRTAAGTVTFDRESLCGEPARTVGWRDPG
FIHTAFLTDLWPNKEYYYKIGHMLPDGKIVWGKFYSFKAPPFPGQKSLQRVVIFGDMGKA
ERDGSNEYSNYQPGSLNTTDTLIKDLDNIDIVFHIGDITYANGYISQWDQFTQQVEPITA
RVPYMIASGNHERDWPNSGSFFNGTDSGGECGVLAETMYYTPTENRANYWYKTDYGMFRF
CVADSEHDWREGTEQYAFIESCLATVDRKKQPWLVFIAHRVLGYSSGFFYGAGGAFAEPT
ARQSLQRLWQRHRVDLAFYGHVHNYERTCPVYDGRCASPERSRYSGAVGGTIHAVVGGGG
SHLSNFTAEAPPWSVYREMDYGFVKLTAFNYTSLLYEYRRSSDGEVHDSFTVHREYRDVL
ACVADSCPPTIPPAT*

5'UTR

chr09:19584868..19584869 (- strand) : 2 bp

CDS

chr09:19584776..19584867 (- strand) : 92 bp

chr09:19584589..19584655 (- strand) : 67 bp

chr09:19584386..19584505 (- strand) : 120 bp

chr09:19584182..19584274 (- strand) : 93 bp

chr09:19583901..19584030 (- strand) : 130 bp

chr09:19583627..19583708 (- strand) : 82 bp

chr09:19583412..19583544 (- strand) : 133 bp

chr09:19583011..19583216 (- strand) : 206 bp

chr09:19582786..19582911 (- strand) : 126 bp

chr09:19581648..19582266 (- strand) : 619 bp

3'UTR

chr09:19581493..19581647 (- strand) : 155 bp

FASTA

>Os09t0506000-03 class=Sequence position=chr09:19581493..19584869 (- strand)
AGGGGGAAGA TACTGCCTGG GTAACTGTTG ATTTCGCAGC TCCGCATGCG AGTGACGGCG ATTGGATCGG AGTATTCTCT
CCTTCAAATT TCAAGTATGA AACAAGTATA TTTGCCATGG ATTTCAAAAT TTGAATAGTG AGACCATGTG ATGTGAGTTT
GTAGATTACA ATCACAATGA CCATGATCTG ATGAACTCTT GCACTTTCCT GCAGCGCGTC CACATGCCCC GGTCCTTCTG
GATCAGACTC AGGACCTGTT ATATGCTCTG CACCAATAAA GGTTTGTAGG AATAATAGCA TCATGTTTGT AAAAGTTCTG
CAAATGAACT CCTAAACTGA TTTTTTTTGT ATGTCTGGTT TCAGTATCAG CTTGCAAATT ATTCTTCAGA TTATGGCAAG
ACAGGAAAAG GCACTCTCAA GTTTCAGTTG ATCAATCAGA GGCAGGACTT CTCCTTTGCA CTGTTCACTG GTGGTCTCTC
AAATGTGAGT TCAAAACATC ACATTGTAAT TTTTTTTTAG ATAATTCACA TTGTAATTTT ATCCAGTCCT TATTACTAAA
GAAATGGCAA CTGACTTAAT GTATTTCATT TCCAGCCAAA GCTTATCGCA GTATCAAATA AGATCGCCTT CGCAAACCCG
AAAGCTCCGG TTTACCCTCG TCTAGCTCAA GGCAAATCCT GGAATGAGGT GAATTATCTT CTTCTCTCTG ACTCACATTT
GCAAATCATC CTCTTCTCTC TGACTCACAT TTGCAAATCT AGATATACAG ATCTAATATG AGATGCATCC TAGCTTAAAA
CGTCAAATCT CTGAAGAATT TGTTGCTTTG TCTTGCTAGA TGACTGTCAC ATGGACTAGT GGTTATGACA TCAAAGAGGC
ATATCCCTTT GTTGAATGGG GCATGAAATG GAGCCCTCCT ACGCGCACAG CAGCTGGCAC CGTCACTTTT GATCGCGAAA
GCTTATGCGG TATGGACCGT ATAAAAGATC CCTTTTATGC ATTATCTTCT GTATATGCAT ATAATAGCAT GAAATTTGTG
AGGAGCTTGC AAAAATGTCA AAATTACACA ATCCTAGATG TCCAATCTTG ATGCCCTGAT GTGGTTTAAA TTGTCTGAAG
TTAGTACATT GTGTTCCTCA CAGTAGTTTT TGCTTGTGCA GGAGAACCTG CCCGTACTGT TGGTTGGAGA GATCCAGGTT
TCATACACAC AGCATTCCTG ACTGATTTAT GGCCAAATAA AGAGTAAATT ACTTCCTATG GCTCTATCAA CATTTTTTTT
CAATTGTGAA TACTGGTCTT CTGACTATGC CATTTTTCCT GCTAGATACT ATTACAAGAT TGGACATATG CTACCTGATG
GAAAAATTGT ATGGGGCAAA TTTTACTCCT TCAAAGCACC TCCTTTTCCT GGGCAAAAGT CACTGCAGAG GGTTGTCATT
TTTGGTGATA TGGGAAAGGT AAAATATACA CCAGCGCAAA ATGTATCGAT AGTTTTAGTA CTCTCTCCTT CAAAAATAAT
TACTCCCTCT GGTCAAAAAT ATTTATCGTT TGGGACAAGA TTTAGTTAAA CTTTTAAGTT CACTGCTTAG CTCAGTCCTG
AAGCAAAACT ACCTCATGTT TCTTCTGAAT TCACATGGTT TTATCACTTG CAGGCCGAGA GGGATGGAAG CAACGAGTAC
AGCAACTACC AGCCTGGATC ACTGAACACA ACTGACACAC TGATCAAGGA CCTTGACAAC ATCGACATTG TATTTCACAT
CGGTGACATT ACCTATGCCA ACGGGTACAT TTCCCAGTGG GATCAGTTCA CTCAGCAAGT CGAGCCGATC ACTGCTCGAG
TCCCCTACAT GATTGCAAGG TCTTTCTTGA TGAACATCTT TGGTTTATTA AATCTCCAAG CCGGTTAACT AATTCTATGA
TAATTACTAA CATGTTTGAT ACGATTGGTT TGATTCAGTG GAAACCATGA ACGGGATTGG CCAAACAGTG GATCTTTCTT
CAATGGGACA GATTCTGGAG GGGAGTGTGG GGTGCTTGCT GAGACCATGT ACTACACACC CACAGAGAAC AGGGCAAACT
ACTGGTAAGT CTCAGACTCT CTCTGTATAT ATAATCAACT CAAATTTCAA TTTCCATTTT TTTAAAAAAA AATTGAATAC
GTTTGTACTG AATTTTGAAT ATTTTTTTCT AAATTTTAGT TGGAGGCACA TTCTTAGTTT ATAAAACCAA CAGAAAAGGC
ATTTTTGTTT TTGAAAACCG GATGTTTCGA GTAAGGTCGA GATCACAAAC TGGCTCGGTG ATGCTCAAAA AGTTCAAACT
AAATCTGAAT TTTGTTGGCA AAATTTGGTC AAATTTCATC GGTAGTCAAC GGATTTCATG AAAAAAAAAT AGGGGAAACC
GTTTCAGAAA GCAGTTCAGT TTTGCGGACT CTGCACGTCC TACTGGGATC CACCGACCTG AAATTTTCAT TCCGAAATTG
TGAACCCTGC TGTCAACTGG TTGCCATTGT AGACCGGAAT GCCTGAATTT TGAACAAACA ATCTTTTATT TTTTTTGCTA
AAATTTAAAA TATTCGAAAT TTGTTCTGAA CTTTGTTGGG Caggtacaag acggactacg ggatgttcag attctgcgtg
gcggacagcg agcacgactg gcgggaaggc acggagcagt acgcgttcat cgagagctgc ctcgccacgg tggaccggaa
gaagcagcca tggctggtgt tcatcgcgca ccgcgtcctc ggctactcct cgggcttctt ctacggcgcc ggcggcgcct
tcgcggagcc gacggcaagg cagagcctcc agaggctatg gcagcggcac cgcgtcgacc tcgccttcta cggCCACGTC
CACAACTACG AGCGGACGTG CCCGGTCTAC GACGGGCGGT GCGCGTCGCC GGAGAGGTCG CGCTACTCCG GCGCGGTGGG
CGGCACCATC CACGCGGTGG TCGGCGGCGG CGGCAGCCAC CTGAGCAACT TCACCGCCGA GGCGCCGCCG TGGAGCGTGT
ACAGGGAGAT GGACTACGGC TTCGTCAAGC TCACGGCGTT CAACTACACG TCGCTGCTCT ACGAGTACAG GCGGTCCAGC
GACGGCGAGG TGCACGACAG CTTCACCGTC CACCGGGAGT ACCGCGACGT GCTCGCCTGC GTCGCCGACA GCTGCCCGCC
GACCATCCCG CCGGCGACGT GATCCAGCTC CGGTGATTCC GCCGGCGAGT CTGCCGGCGA CGTGTGCACT ATTGCTGCTT
GGTGGTGCTT GCGGGCCTCG TCTGTAATCT TGACTTGTCA ATCGTGTGTA AATTGAATTG CGAAATATTT CGAAATTAAG
TCAAATAAAG AAATGTT

Locus: Os09g0506000

Loading...

Locus: Os09g0506000

Loading...