Os09t0506800-02

Locus

Os09g0506800

Description

Similar to Essential protein for meiotic synapsis.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAIR2

CGSNL Gene Name

HOMOLOGOUS PAIRING ABERRATION IN RICE MEIOSIS 2

Oryzabase Gene Symbol Synonym(s)

Pair2, OsPAIR2, OsASY1

Oryzabase Gene Name Synonym(s)

Homologous pairing aberration in rice meiosis 2

Transcript Evidence

AK102636 (DDBJ, Best hit)

Protein Evidence

Q76CY8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: mitosis (GO:0007067)

Functional domain (InterPro)

DNA-binding HORMA (IPR003511)

Full-length cDNA

J033099N16 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0506800-02)

RiceXPro (AK102636)

Others

Oryzabase (8428)

KEGG (Os09t0506800-02)

Transcript

2117 bp

>Os09t0506800-02 Similar to Essential protein for meiotic synapsis.
ACTCCTCTCCCCTCTCCCTTCTCTCATCTCGCGCGCGGCGCGCCGCCGTAGAGACGAAAT
GGTGATGGCTCAGAAGACGAAGGAGGCGGAGATCACGGAGCAGGATTCGCTGCTTCTGAC
AAGGAATTTGCTCCGCATTGCTATATACAACATCAGCTACATCAGAGGTCTATTCCCTGA
GAAGTACTTCAATGATAAGTCGGTTCCGGCACTAGAGATGAAGATTAAGAAGCTAATGCC
CATGGATACTGAGTCGAGGAGGTTGATTGATTGGATGGAAAAAGGTGTCTATGATGCACT
ACAGAAGAAATATCTCAAGACCCTTCTCTTCTGCATCTGTGAGAAGGAGGAAGGCCCAAT
GATTGAGGAGTATGCATTCTCATTTAGCTACCCCAACACGAGCGGTGATGAAGTTGCAAT
GAACTTGAGCCGCACAGGGAGCAAGAAAAACAGTGCTACATTTAAATCAAATGCAGCAGA
AGTCACTCCTGATCAGATGAGGAGCTCTGCTTGTAAGATGATAAGAACACTGGTTTCACT
TATGAGGACCTTGGACCAAATGCCAGAGGAGAGGACCATTCTAATGAAGCTGCTATACTA
CGATGATGTCACACCTGAAGATTACGAGCCACCCTTTTTTAAGTGTTGCGCTGACAACGA
GGCCATAAATATATGGAACAAGAACCCCTTGAAGATGGAAGTTGGAAATGTCAATAGCAA
GCATCTCGTGTTAGCTTTGAAGGTCAAGAGTGTCCTTGACCCTTGTGATGATAACAATGT
CAACAGTGAAGATGATAATATGAGCTTGGATAATGAATCTGACCAAGATAATGATTTTTC
TGACACTGAGGTTCGCCCATCTGAAGCAGAGCGTTACATTGTTGCTCCAAATGATGGGAC
TTGCAAAGGTCAAAATGGTACAATCTCAGAAGATGATACTCAAGATCCTGTTCACGAGGA
AGAGCTAACAGCTCAAGTAAGAGAGTGGATATGCTCAAGAGACACTGAAAGTCTTGAGGT
TTCAGATGTCCTTGTTAATTTCCCCGACATATCAATGGAAATGGTTGAAGATATTATGGA
GAGGCTACTTAAAGATGGTTTACTATCCAGAGCAAAAAAGGATAGTTATTCTGTTAATAA
GATTGCTGATCCTACAACACCACACATAAAGAAAGAGGTCATCATGCAAAATGTCTCACC
TACTgaaggaactaaaaatagcaatggtgatctgatgtatatgaaggcactgtaccatgc
acttccaatggattatgtgtcagtaggcaaacttcatggcaagctagatggggaggccag
ccagaacatggttcgtaagttgattgaaaaaatggtgcaagacggatatgtcaagaattc
agccaaccGAAGACTAGGCAAAGCTGTCATTCATTCTGAAGTCACCAACAGAAAGCTCCT
TGAGATAAAAAAGATTCTGGAAGTCGATATAGCCGAACAAATGGCCATTGATACCAATGC
AGAACCTGGTGAGCCTGAGCGCAAAGACCACCTGAGTGGCCATGAAATGAGAGATGGATC
GACGATGGGTTGCCTCCAGTCCGTCGGATCTGACCTCACCCGCACCCGGGAGCTTCCGGA
GCCGCAGCAGAACGTGTCCATGCAGAGCGGGCAGGAAGCTTCCACGGTGGATAAGGATCC
AAGCAGGACTCCTACAAGCGTGCGCGAGCAGGCGTCCGTTTGTTCCCTGGAGAGTGGGGT
TCTCGGGCAGAAGGTCAGAAAGTCTTTGGCTGGTGCTGGCGGGACGCAGTGCTCGCAGGA
CAAGCGATTCAGGAAGGCCAGCACGGTGAAGGAGCCGATCCTCCAGTACGTCAAGCGCCA
GAAGTCCCAAGTTCAAGTTCAAGTTCAGTGAGGGTTCGTGTCGCAAGCGTCAGGAGCAAC
TAACATCGTAGTTCAGGTGCAGAAGACCACAAGTAGATATATCCATCCTATTCCTAGTTC
CGGTGCTCAAGTTTGTGCAGATAGTCAGAGAGCACTCACGCACACGTAGATATCTGTCCA
TGCCGCTGTCCCAAATGGCAAATGGAGATAGACGCTACTATGTGCTAACACACACTCAAA
TTAAGCATTCAAAACGC

CDS

1833 bp

>Os09t0506800-02 Similar to Essential protein for meiotic synapsis.
ATGGTGATGGCTCAGAAGACGAAGGAGGCGGAGATCACGGAGCAGGATTCGCTGCTTCTG
ACAAGGAATTTGCTCCGCATTGCTATATACAACATCAGCTACATCAGAGGTCTATTCCCT
GAGAAGTACTTCAATGATAAGTCGGTTCCGGCACTAGAGATGAAGATTAAGAAGCTAATG
CCCATGGATACTGAGTCGAGGAGGTTGATTGATTGGATGGAAAAAGGTGTCTATGATGCA
CTACAGAAGAAATATCTCAAGACCCTTCTCTTCTGCATCTGTGAGAAGGAGGAAGGCCCA
ATGATTGAGGAGTATGCATTCTCATTTAGCTACCCCAACACGAGCGGTGATGAAGTTGCA
ATGAACTTGAGCCGCACAGGGAGCAAGAAAAACAGTGCTACATTTAAATCAAATGCAGCA
GAAGTCACTCCTGATCAGATGAGGAGCTCTGCTTGTAAGATGATAAGAACACTGGTTTCA
CTTATGAGGACCTTGGACCAAATGCCAGAGGAGAGGACCATTCTAATGAAGCTGCTATAC
TACGATGATGTCACACCTGAAGATTACGAGCCACCCTTTTTTAAGTGTTGCGCTGACAAC
GAGGCCATAAATATATGGAACAAGAACCCCTTGAAGATGGAAGTTGGAAATGTCAATAGC
AAGCATCTCGTGTTAGCTTTGAAGGTCAAGAGTGTCCTTGACCCTTGTGATGATAACAAT
GTCAACAGTGAAGATGATAATATGAGCTTGGATAATGAATCTGACCAAGATAATGATTTT
TCTGACACTGAGGTTCGCCCATCTGAAGCAGAGCGTTACATTGTTGCTCCAAATGATGGG
ACTTGCAAAGGTCAAAATGGTACAATCTCAGAAGATGATACTCAAGATCCTGTTCACGAG
GAAGAGCTAACAGCTCAAGTAAGAGAGTGGATATGCTCAAGAGACACTGAAAGTCTTGAG
GTTTCAGATGTCCTTGTTAATTTCCCCGACATATCAATGGAAATGGTTGAAGATATTATG
GAGAGGCTACTTAAAGATGGTTTACTATCCAGAGCAAAAAAGGATAGTTATTCTGTTAAT
AAGATTGCTGATCCTACAACACCACACATAAAGAAAGAGGTCATCATGCAAAATGTCTCA
CCTACTgaaggaactaaaaatagcaatggtgatctgatgtatatgaaggcactgtaccat
gcacttccaatggattatgtgtcagtaggcaaacttcatggcaagctagatggggaggcc
agccagaacatggttcgtaagttgattgaaaaaatggtgcaagacggatatgtcaagaat
tcagccaaccGAAGACTAGGCAAAGCTGTCATTCATTCTGAAGTCACCAACAGAAAGCTC
CTTGAGATAAAAAAGATTCTGGAAGTCGATATAGCCGAACAAATGGCCATTGATACCAAT
GCAGAACCTGGTGAGCCTGAGCGCAAAGACCACCTGAGTGGCCATGAAATGAGAGATGGA
TCGACGATGGGTTGCCTCCAGTCCGTCGGATCTGACCTCACCCGCACCCGGGAGCTTCCG
GAGCCGCAGCAGAACGTGTCCATGCAGAGCGGGCAGGAAGCTTCCACGGTGGATAAGGAT
CCAAGCAGGACTCCTACAAGCGTGCGCGAGCAGGCGTCCGTTTGTTCCCTGGAGAGTGGG
GTTCTCGGGCAGAAGGTCAGAAAGTCTTTGGCTGGTGCTGGCGGGACGCAGTGCTCGCAG
GACAAGCGATTCAGGAAGGCCAGCACGGTGAAGGAGCCGATCCTCCAGTACGTCAAGCGC
CAGAAGTCCCAAGTTCAAGTTCAAGTTCAGTGA

Protein

611 aa

>Os09t0506800-02 Similar to Essential protein for meiotic synapsis.
MVMAQKTKEAEITEQDSLLLTRNLLRIAIYNISYIRGLFPEKYFNDKSVPALEMKIKKLM
PMDTESRRLIDWMEKGVYDALQKKYLKTLLFCICEKEEGPMIEEYAFSFSYPNTSGDEVA
MNLSRTGSKKNSATFKSNAAEVTPDQMRSSACKMIRTLVSLMRTLDQMPEERTILMKLLY
YDDVTPEDYEPPFFKCCADNEAINIWNKNPLKMEVGNVNSKHLVLALKVKSVLDPCDDNN
VNSEDDNMSLDNESDQDNDFSDTEVRPSEAERYIVAPNDGTCKGQNGTISEDDTQDPVHE
EELTAQVREWICSRDTESLEVSDVLVNFPDISMEMVEDIMERLLKDGLLSRAKKDSYSVN
KIADPTTPHIKKEVIMQNVSPTEGTKNSNGDLMYMKALYHALPMDYVSVGKLHGKLDGEA
SQNMVRKLIEKMVQDGYVKNSANRRLGKAVIHSEVTNRKLLEIKKILEVDIAEQMAIDTN
AEPGEPERKDHLSGHEMRDGSTMGCLQSVGSDLTRTRELPEPQQNVSMQSGQEASTVDKD
PSRTPTSVREQASVCSLESGVLGQKVRKSLAGAGGTQCSQDKRFRKASTVKEPILQYVKR
QKSQVQVQVQ*

5'UTR

chr09:19620684..19620741 (+ strand) : 58 bp

CDS

chr09:19620742..19620744 (+ strand) : 3 bp

chr09:19620820..19620876 (+ strand) : 57 bp

chr09:19623640..19623736 (+ strand) : 97 bp

chr09:19623829..19623897 (+ strand) : 69 bp

chr09:19623981..19624073 (+ strand) : 93 bp

chr09:19624189..19624312 (+ strand) : 124 bp

chr09:19624899..19624968 (+ strand) : 70 bp

chr09:19625041..19625082 (+ strand) : 42 bp

chr09:19625240..19625368 (+ strand) : 129 bp

chr09:19625463..19625570 (+ strand) : 108 bp

chr09:19625724..19625766 (+ strand) : 43 bp

chr09:19625835..19625873 (+ strand) : 39 bp

chr09:19626071..19626195 (+ strand) : 125 bp

chr09:19626392..19626404 (+ strand) : 13 bp

chr09:19626499..19626569 (+ strand) : 71 bp

chr09:19626661..19626765 (+ strand) : 105 bp

chr09:19626844..19626994 (+ strand) : 151 bp

chr09:19627510..19627595 (+ strand) : 86 bp

chr09:19627703..19627757 (+ strand) : 55 bp

chr09:19627854..19628023 (+ strand) : 170 bp

chr09:19628152..19628268 (+ strand) : 117 bp

chr09:19628387..19628452 (+ strand) : 66 bp

3'UTR

chr09:19628453..19628678 (+ strand) : 226 bp

FASTA

>Os09t0506800-02 class=Sequence position=chr09:19620684..19628678 (+ strand)
ACTCCTCTCC CCTCTCCCTT CTCTCATCTC GCGCGCGGCG CGCCGCCGTA GAGACGAAAT GGTGGGTTCT CGCTTCGATT
TCGCGTTGCG CTTGCTGGTG TGTGCGTGCT GATCGGAGTG GGTGATTGCG ATGCAGGTGA TGGCTCAGAA GACGAAGGAG
GCGGAGATCA CGGAGCAGGA TTCGCTGCTT CTGGTGAGTT TTTTTTTCTC TCCTCGCCCA TCTCCTGTTC GATTCCCGTG
CGACTTTCGA TTTCGGTGGT TCGGTGCCGG ACATCGGATC GGTTCACCCG ATCGAGGGTT TTCTGCCGAG GTTTTTGGGA
GGTTTTTCGC TGTGGATTTG ATCGCTCGTG TGGTGTACTG GGGTTTGCAG TAGCTGGCGT TCGATTTGGG TTTGATTCGA
GTGTTGGTGG TCACGCGTGT CGGATTTCCC CCCCCCCCCC ACTTTGCGAG TGCTTTTGGG TGGAATTAAC TGTTGCTTTG
CTGATTTTAA CCGATTTCTC GTGCGGATTT TGGATGTGTT TGGAGATCGT CGTGGGGTTT TGGGTTTCTC GCTTTCTCTG
GTAGTCTCCG TCCGCTGACT ACCAAATGGT GCTAGTTGGG CGGCCAGTGC GAAGCATCAG TAGCATCTCA CTTTGCTAGT
GTTTTTGGGT GGATTTCATT GGTGCTTTGC AGATTTTAAC CGATTTCTCG TGCGGATTTA GGCGTGTTTG GAGCATGAGT
CCTGGGATTT TTGTTTCACT TCCTCTGGTG CTCTCCGCCC GTTCAAAAGC TTCTGGGTAT CTCAGATTGG AGTTGGTTTC
TGGTTTCTCC GTGTAGCACT ATCTCTCGAA TGCGTAACTG ATGGATCGTT TCGGTATCGC ACTGAATGAT GATTCGGTGG
TTTTTCTCCC TGCTGCTTGA TCGATGTGAG TTTTGTTTCT CTGGTTTGAG GCACCGAATC TGTTCTCGTG AAAATTTTTT
GACATAATGT TCTCGTGAAA AATCTCTGGT TGGTTTGCTA AATTTCGCAG AAATTTTGAG CAGAATTTCT ACTGGTTTGT
GCGATTCTCT CAGCATTAGA ATTTTGTTGA ACGGATCACA TCACTTTGTT TTGCTACTCG CGTGGTGATT CGGTTGGGAT
TTCAAGGAGA CATTCACTGG TTTGATAATC GCGTTTCGAT TTGGTTTCGT TGTGATACCC ACAGGCATTT GCCTGATTGT
TTGTGCGTAG ACCATCGTGC TGGAAACATA GGCGCATAGT CTCTGCAGTC TGCGTAGTTG ATCAAATTGG TAGGGTTGAA
AGTTTTTTTC CCTGGCTTAG ATATCCTTGC GAAGAATTTC GAATTCAAGT CGTGTTGTTT CGAACTGTTT CGCCAGAAGC
ATCTAAGGAA TTGTTCAGTT CGTTGAACTT CTCATGTGCT TTGCGTTTGG AATCTCTTCT GAAGTGTTTT GGGAGCAGCA
GTTACAGTGA GTAACTTCAT TTTGCTTCCG AAATGCTTGC TTGAACATGG AATCGAGACA CGACTCGTAT TGGCCTGGGC
CTGGTTGTTC AGGATTTCCA TTTCTGACAG TCGTATGAGT CGATTTTTTC AAATGTTTCC AGTAGGCTTG TTAGTTGTTT
GGGTTTTGAA CAAACGTTGC CTACCTTGGT TGGAATTCTA GGAGACATTC GCTGGTTTGA TAATCCCGTT TCGTTTTTGT
TTCGTTGTGA AACCCACGAG CATTGGCCTG ATGATTTGTG CGTAGATGAT TATATGCTGG AATCATGGGT GCATACCCCC
CACGGTTCAC TGAATCGATC AAATTGGCAG GGCCTAAAAA GGTTTTTTCC TTGCTTCCAT AGCCTTGTGA AGAGTTTCTA
CTTCCAATCG TTTTGAATCA TATTGTTAGA AGCATCTAAA ATTTATTCAG TTCGTTGAAT TCTTGCTGTG CTTGCTTTTG
GTATCTCTTT AGACTTCAGA GTTTTTTTGG CAGCAGCAGA TTCCATGAGT AATTTTAGTT TCTCTTTTCA AACTTGTTGC
TTGGACGTGG AATTGAGACA CCACAGTACC ACACGTATTG GTTTGGTTAT TCCCAGATTT CCTGTTCTGA TAGTTCTATG
ACCTAATTCT TCTTCTGTTT TTTAAAATAT TTCCGATACA CTACTTTGGG TTTGAACAGA CATTTGCTTA ATCCTGCATT
AGTTTGTGAT AAGAAAAGCT GCACTTCTGT TTATAATCGG TTATTTTGTT GCGCTATCAT TTGAATTTGG AATTTATGTT
ATGCCTTTAG GAATTATATG CCAGCTTATT AAACCTCTGC TGGCATGATT TTTAGACTAG CCCCCACTCT CACTCCTATT
TTAACATCTT TGTTAGATAC TCGGTTTAAT AAGTGGACAT TGGCTTTGCC ACATGAGTTT TAGGATTACT GGTTGATCAC
CAAACTTTGG TACCTCTTGT ACTTTCAAAA AACCAGTTGG TTTATATCCA ATCAAATAAT GTTTTTCTTT GTCTTTTCTA
GTACTTGTTT GCTCACATGG TCAGCTGCAC TTTGCCTAGA AGTGCTTAGG ATCCCATGAC TGCAAGTGCA TAGTAGGTGA
AATATATCGT ATGGTCCATG TTCATTTATG CATTTGTTAA GAAATTTATT GCAGGTGTGT GTTTGAATGG GACTGGTACC
CTATTTGATT CAACATGTGC TAAAGTATTG AAAAGCATGA CACATTTGTT GTTTGGTGAA CTTTTGTGCC TCACCTTGTT
TGGCAAGCCC AAAACCCTGG GCCATGCTCC AGGATGGGCT AGGAAACTGA ACTACAATTT CAGTCCATCC CTGGGGGTGG
ACCAGGATCC AATAAGGCCT AAACTTGTTA ATCAGTAATC CAATTTGTGA TGATTTTATT GCCCTTCTAT TTCTATTACA
TTGAATACTG AACTCTCTTT GAATTATGTA TGGTAGAACG CTATTGTGAT AACGTGGTGA TATTTTGACC AAACAGACAA
GGAATTTGCT CCGCATTGCT ATATACAACA TCAGCTACAT CAGAGGTCTA TTCCCTGAGA AGTACTTCAA TGATAAGTCG
GTTCCGGCAC TAGGTCACAT TACCTATAGT CCCTAACCCT TTTATACACC AAATTCCTCA GATGATATGA TATTATTAGC
TGGAACACCC TTTTATTTAT TGCAGAGATG AAGATTAAGA AGCTAATGCC CATGGATACT GAGTCGAGGA GGTTGATTGA
TTGGATGGAA AAAGGTGAAA ATATGTCCTG TTTTACGTGT TAAATCTTTT TAATTTTCCA ATTTGTTCAT TTAATCCATT
TTTGTGATAA ATTTTAGGTG TCTATGATGC ACTACAGAAG AAATATCTCA AGACCCTTCT CTTCTGCATC TGTGAGAAGG
AGGAAGGCCC AATGATTGAG GAGTATGCAT GTGAGTATTA CCATGTGAAA TATGGCTAAC TTCTAGCATA CAAAGTTGGT
TTTACATCAG TGATTGTGGG TCATATGTCA AACATTTTCT TATTCTGTGT CAAACTCCCC TGCAGTCTCA TTTAGCTACC
CCAACACGAG CGGTGATGAA GTTGCAATGA ACTTGAGCCG CACAGGGAGC AAGAAAAACA GTGCTACATT TAAATCAAAT
GCAGCAGAAG TCACTCCTGA TCAGATGAGG TTCTCTCATA CATATCCCTT TTAAAGGCTA TGATTCATTC TAGACTTCTA
GTTAGTTATC CATGCTGCTT AGCTAAATGC TACGATTTAA TGGTTAATTT TTCATATTGC TTAGCATTAT ACATTTTGGA
GAGTGTTTGT TTAATGAAGT TGCAGTCCCA ACATAACAAT AGTTTAAAAT TTTATGATTT CAAAGAAGTA GGAGCAAATT
GATGACTAAA AGGAGTTCAG ATTTTCTTTT TCTATGTAAG GAATGTGGTG AAAAAGTGAG GTACATAGAT TCCAGTAACT
TTGTAAATTT AGGTACATAG GACTGTGAGG TGGCAATAAA TGATGTAAAT CCTTTTTAAA AACATAGTTG GGCTTATAAT
TTTGAGTCCA ACTTTTCTGC GAGTTGTTCT TAAATATTCT TCCACAACTT GCAGAATTCT AGTTCTGAAG GTATGGTTTC
AATTTAGTCC TTTAGATAAG CTCATTAATG GTTGTTTATT GGTTTTTATA TGTGTATGGC AATTGCAAAG TAATTATTGT
AAGCTTTAAC TAGTCACTGC TGATATCCTG ACATGATCAT ATGGTTCCCA ATCAGGAGCT CTGCTTGTAA GATGATAAGA
ACACTGGTTT CACTTATGAG GACCTTGGAC CAAATGCCAG AGGAGGTAAT TTTTGCACTT CACAGATTTG TTACAATGGA
TTGAACTTAC CTAATGCTAT CCTGTATTTG TCCTCAGAGG ACCATTCTAA TGAAGCTGCT ATACTACGAT GATGTCACAG
TGAGTGCAGC AATTTGTTCT TGCTATTTAC TGAAACTTGA AGCCGCCATA ATAGATAATT ATTTTTGCTC TGAACAAATG
AAGGATTCAA CCTTTTCTGT TCTATAGAAC TTTGTTCGTG GAATCGAAAA CAGTTAATTT ATTATGCTAT TTGCAGCCTG
AAGATTACGA GCCACCCTTT TTTAAGTGTT GCGCTGACAA CGAGGCCATA AATATATGGA ACAAGAACCC CTTGAAGATG
GAAGTTGGAA ATGTCAATAG CAAGCATCTC GTGTTAGCTT TGAAGGTAGT GGATTATGGA GATAGCAGTC GTTTGGACCA
GGAAACCTCT GTTTTCTCAA TTAAACTCAT TGCTACATAT GTTTTTATTC TTTATGCAGG TCAAGAGTGT CCTTGACCCT
TGTGATGATA ACAATGTCAA CAGTGAAGAT GATAATATGA GCTTGGATAA TGAATCTGAC CAAGATAATG ATTTTTCTGA
CACTGAGGTA AAGACCTAAG AGAACATATA ATTGAGCATC TTTATTAGTG AGATTCTCTT AATTTTCTCC TTAGTGTGCT
GTGATGCCAC CTTTCGATGT ATACGCATAT TTTTGTCTTC CTTTTACCTG TAGTATAGAC TGAATCGCTA ATTCTATTAG
GTTCGCCCAT CTGAAGCAGA GCGTTACATT GTTGCTCCAA ATGGTAAAGT TTCTTTGTTT GTATTCTTGT TGTACTTTCT
GTTTTTGGTG CTAACATACT TATCAAAATA GATGGGACTT GCAAAGGTCA AAATGGTACA ATCTCAGAAG GTCAGTTAAT
TTGATCTGAG AGCTTCATCT GTGCATCCTT TTCCATACAA ATGAATTTTA TGTCAACTAT TAAGTTATTA TTCAAATGTT
TGGATGCTCA TTTAATTTTT CATGAAGTGT GCAATACATG TTCAACATTC TCTGACTCTG TAGTACCTGA AAATTTCATA
CGTTTCTCTG ACTTTGTATG TTTGCAGATG ATACTCAAGA TCCTGTTCAC GAGGAAGAGC TAACAGCTCA AGTAAGAGAG
TGGATATGCT CAAGAGACAC TGAAAGTCTT GAGGTTTCAG ATGTCCTTGT TAATTTCCCC GACATATCAA TGGTAATGCC
TACTGGTATT TCATTTATAT AATAAAATAG CTATTTAGAG TATTTACTGT TTTGTGCTAG ACTTACAAGT AGGTCACAAA
CTTTTACCCG CTTTTATGTC ATCAGTGTTT ATAAATCAAA CAATATCTTG ATATACTGTA TGAGCTGTAT GGCTGGCTAT
TAACAATATC TTGTTGAATG CTTTGCAGGA AATGGTTGAA GGTAGTGGTG TGAAAAACTT ATGTGTGCTT ACCAGGCATT
CTTTCTTCAC TCTCACTAAA GCCTTGAAAT ACTTGACTAA TGACTCACTT TTCAGATATT ATGGAGAGGC TACTTAAAGA
TGGTTTACTA TCCAGAGCAA AAAAGGATAG TTATTCTGTT AATAAGGTCA ACCAAACATT TTCTTCATGT GCTATATTTT
AGTTTTACCC TGTGGCATAT TGTACTGTCC ATCACTAGCA TCATAGAGTG GCTTCAGATT GCTGATCCTA CAACACCACA
CATAAAGAAA GAGGTCATCA TGCAAAATGT CTCACCTACT gaaggaacta aaaatagcaa tggtgatctg atgtatatga
aggtgtatct ctgtcgctta cccttggctt gtatttggag gtcatcatgt catttctgct gatatatatc gttgctacag
gcactgtacc atgcacttcc aatggattat gtgtcagtag gcaaacttca tggcaagcta gatggggagg ccagccagaa
catggttcgt aagttgattg aaaaaatggt gcaagacgga tatgtcaaga attcagccaa ccGAAGACTA GGTAACACCT
TGAACTAATC TCTTGCAAAA TCTCAAATGC TTCTATTCTA TGGTACATTA TTTACTTTTC TGGTTTAGTC TGTCAGCCAG
GAGCAAGTTA TGTATTGTTT GCTCAATTCT GTTACAACTG TGAAAGGAGA ATAACTGAAT CAACATGCCA ACTGAGTGTC
ATTTTCTACA TAGATTGTGC AACTTCAAGT GATTACCTTT TGTCATGTTC ACTTATTATA TGAAGAACTG TCAACAACTT
CTCTTGAAGA AGGATTTTGG ATGCCTCATG AAAAACATTG TCTAACTGTA ATACTTGTGA AGAATATACA TGTACTGAAG
CTGTTGCTGC TTTAGATGAA AACTAATGAT TTTAGGAACT TCAGATACAT CACTCTTATC TTTTCAGATT GACCATTGCC
GCCATGCATT GTACTAATAG AACTAGTACT AATCTTTGAG CAAATGACTG ATTCACTACT ACTGTGCACC ATACCATCTT
ATGGCCTATG TCACTCTATT TTACAGGCAA AGCTGTCATT CATTCTGAAG TCACCAACAG AAAGCTCCTT GAGATAAAAA
AGATTCTGGA AGTCGATATA GCCGAACAAA TGGTACCATA ATCATATCTA ACAGCACCAA GTTTTTATCT AGTAATTCTT
TGCATTCCAC AACATTCATT TTATTCATGG TTAATCTGAA ACTCTGCTTC ATCATGCAGG CCATTGATAC CAATGCAGAA
CCTGGTGAGC CTGAGCGCAA AGACCACCTG AGTGGTAATG GCAACAACAA TCCGCATCTC CATGGACTTG GCATCTGTCT
TTGCGTATAT AGTACTAACA TGACATTGTC CAATATGTTT CTCTTTATAG GCCATGAAAT GAGAGATGGA TCGACGATGG
GTTGCCTCCA GTCCGTCGGA TCTGACCTCA CCCGCACCCG GGAGCTTCCG GAGCCGCAGC AGAACGTGTC CATGCAGAGC
GGGCAGGAAG CTTCCACGGT GGATAAGGAT CCAAGCAGGA CTCCTACAAG CGTGCGCGAG GTATAACCGA AACCTGATCC
CCTACTAACC ACAGACGATT CTGAGCCATA TGCGACTCAG AATCCAGGTA AATTAAATCA CAGACAAACG TAGAGCTGAA
GGTGATGAAC TGTGTGATAC CTTTGCAGCA GGCGTCCGTT TGTTCCCTGG AGAGTGGGGT TCTCGGGCAG AAGGTCAGAA
AGTCTTTGGC TGGTGCTGGC GGGACGCAGT GCTCGCAGGA CAAGCGATTC AGGAAGGCCA GCACGGTAAA CTCTCCATGT
CCCAACTCTG AACTGAAACA TCTGGCATTT GGCATGTACT AGTATTTGGC ATTTGGCGCT GTAATCAAGT TGAGTTTAAT
TGATCCCGTG AAAATGACCG CAGGTGAAGG AGCCGATCCT CCAGTACGTC AAGCGCCAGA AGTCCCAAGT TCAAGTTCAA
GTTCAGTGAG GGTTCGTGTC GCAAGCGTCA GGAGCAACTA ACATCGTAGT TCAGGTGCAG AAGACCACAA GTAGATATAT
CCATCCTATT CCTAGTTCCG GTGCTCAAGT TTGTGCAGAT AGTCAGAGAG CACTCACGCA CACGTAGATA TCTGTCCATG
CCGCTGTCCC AAATGGCAAA TGGAGATAGA CGCTACTATG TGCTAACACA CACTCAAATT AAGCATTCAA AACGC

Locus: Os09g0506800

Loading...

Locus: Os09g0506800

Loading...