Os09t0509100-01

Locus

Os09g0509100

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC001, ONAC1

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 001, NAC domain-containing protein 1

Transcript Evidence

AK060509 (DDBJ, Best hit)

Protein Evidence

NP_001151020.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

001-019-D01 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0509100-01)

RiceXPro (AK060509)

Others

Oryzabase (11454)

KEGG (Os09t0509100-01)

Transcript

1237 bp

>Os09t0509100-01 No apical meristem (NAM) protein domain containing protein.
ACTCATCATCAAACTCTCTCTCTCTCTCTCTCTCTCTCTGAATCTCTGGATCTCTGAAAA
CTCTGAACATTCCAAGAACTCATAAGTTACCTGTGATCTGTGAAGCTTGAGCTGAAGCTG
TGACAGTGTCTCACTGATCGTTGATCACTCAGCTTGGCTGCTACTGTGCATTCACTGCGT
GGTTAGCTAGCTAACTGAGCAGAAGAGCTTTAGCAATGGCGACGCCGGGGCAGCagctgc
cgccggggttcaggttccacccgacggacgaggagctggtggtgcagtacctccggcgga
gggcgctgtgccggccgctccccgccgccgtcatcccggacgtccacgacgccaccgtgc
tcgacccctgggacctccccgGCGCCGGCGATGGTGAGGCCTACTTCTTCAGCTTCCGGC
AGCTCGCGGCGGCGAGCGGCGGCGGCGGGTGGCGGAGGAGGAGGGCGGGGAGTGGGTACT
GGAAGGCGACGGGGGCGGAGAAGCCGGTGTTCCTGCGTGGCTTCGGGTGCGGCGGCGGCG
GCGGCGGCGGCGGCCAGCACCTCGTCGGCGTCAAGACGACGCTGCTCTTCCTCCGCGCGA
AGCCGCCGTCGCGCACCCACTGGGTCATGCACGAGTACCGCCTCGCCGCCGCCGGCGCTG
TCGCCGTCGCCGCCGCCGGACAGACAAAGCGCGGGAACCATAGTTGCATGGCTCAGCCAG
GAGAATGGGTGGTGTGCCGGATTTTTCTGAAGAACAACAGGTCATCAAGAAGGCGAGCCG
GCGACGCCGACGGCGAAACGCCGGTCACCGGTGTCCACGGTCACCGTCGGCGGCAGCCGT
CGCCGTCGCCGTCGTCGTCGAGCTGTGTCACGGCTGAGGTTTCAGACGGAGAAGGAGAAG
AAGAAGTCAGCAGTGGCAGCATCAATGGTGCTCCATCTGCCTCTCAAAGAGAGGCCTAGA
CATGCTGAAAATCTCCTTAATTAATTACTAGTACTAGTGATTTTTTTTCTTCTTCTTCTT
GTTCTCTTTTGTCCCTCCATTGCTTTTCCTGTACTTCTCCTTGTACCATAATGATTAGTA
GGAGTTTAAGTTTAAGCAGCAGGTTGAAGAGAGAAGCCCCAGCTTAAGAAAGCTCCTAAG
TAAAGATTACTGAGCAGCAGCTGTGACATCTGTATCAATTGTAACTTGTAAGTTTCTCTT
GATCATTTATTAAGATAAGGAACCTCAATTAAGCAGG

CDS

744 bp

>Os09t0509100-01 No apical meristem (NAM) protein domain containing protein.
ATGGCGACGCCGGGGCAGCagctgccgccggggttcaggttccacccgacggacgaggag
ctggtggtgcagtacctccggcggagggcgctgtgccggccgctccccgccgccgtcatc
ccggacgtccacgacgccaccgtgctcgacccctgggacctccccgGCGCCGGCGATGGT
GAGGCCTACTTCTTCAGCTTCCGGCAGCTCGCGGCGGCGAGCGGCGGCGGCGGGTGGCGG
AGGAGGAGGGCGGGGAGTGGGTACTGGAAGGCGACGGGGGCGGAGAAGCCGGTGTTCCTG
CGTGGCTTCGGGTGCGGCGGCGGCGGCGGCGGCGGCGGCCAGCACCTCGTCGGCGTCAAG
ACGACGCTGCTCTTCCTCCGCGCGAAGCCGCCGTCGCGCACCCACTGGGTCATGCACGAG
TACCGCCTCGCCGCCGCCGGCGCTGTCGCCGTCGCCGCCGCCGGACAGACAAAGCGCGGG
AACCATAGTTGCATGGCTCAGCCAGGAGAATGGGTGGTGTGCCGGATTTTTCTGAAGAAC
AACAGGTCATCAAGAAGGCGAGCCGGCGACGCCGACGGCGAAACGCCGGTCACCGGTGTC
CACGGTCACCGTCGGCGGCAGCCGTCGCCGTCGCCGTCGTCGTCGAGCTGTGTCACGGCT
GAGGTTTCAGACGGAGAAGGAGAAGAAGAAGTCAGCAGTGGCAGCATCAATGGTGCTCCA
TCTGCCTCTCAAAGAGAGGCCTAG

Protein

248 aa

>Os09t0509100-01 No apical meristem (NAM) protein domain containing protein.
MATPGQQLPPGFRFHPTDEELVVQYLRRRALCRPLPAAVIPDVHDATVLDPWDLPGAGDG
EAYFFSFRQLAAASGGGGWRRRRAGSGYWKATGAEKPVFLRGFGCGGGGGGGGQHLVGVK
TTLLFLRAKPPSRTHWVMHEYRLAAAGAVAVAAAGQTKRGNHSCMAQPGEWVVCRIFLKN
NRSSRRRAGDADGETPVTGVHGHRRRQPSPSPSSSSCVTAEVSDGEGEEEVSSGSINGAP
SASQREA*

5'UTR

chr09:19749085..19749299 (+ strand) : 215 bp

CDS

chr09:19749300..19749465 (+ strand) : 166 bp

chr09:19749566..19749885 (+ strand) : 320 bp

chr09:19750403..19750660 (+ strand) : 258 bp

3'UTR

chr09:19750661..19750938 (+ strand) : 278 bp

FASTA

>Os09t0509100-01 class=Sequence position=chr09:19749085..19750938 (+ strand)
ACTCATCATC AAACTCTCTC TCTCTCTCTC TCTCTCTCTG AATCTCTGGA TCTCTGAAAA CTCTGAACAT TCCAAGAACT
CATAAGTTAC CTGTGATCTG TGAAGCTTGA GCTGAAGCTG TGACAGTGTC TCACTGATCG TTGATCACTC AGCTTGGCTG
CTACTGTGCA TTCACTGCGT GGTTAGCTAG CTAACTGAGC AGAAGAGCTT TAGCAATGGC GACGCCGGGG CAGCagctgc
cgccggggtt caggttccac ccgacggacg aggagctggt ggtgcagtac ctccggcgga gggcgctgtg ccggccgctc
cccgccgccg tcatcccgga cgtccacgac gccaccgtgc tcgacccctg ggacctcccc ggtGCGGTTT TCTTGATCCG
TTTTGGTTTC GAGGAGGTGC GGCGCCATTG CCAAGCTCGA CCGAGCGGGA GACTGATCGT GAACTCTCTC CTTCTGTGCA
GGCGCCGGCG ATGGTGAGGC CTACTTCTTC AGCTTCCGGC AGCTCGCGGC GGCGAGCGGC GGCGGCGGGT GGCGGAGGAG
GAGGGCGGGG AGTGGGTACT GGAAGGCGAC GGGGGCGGAG AAGCCGGTGT TCCTGCGTGG CTTCGGGTGC GGCGGCGGCG
GCGGCGGCGG CGGCCAGCAC CTCGTCGGCG TCAAGACGAC GCTGCTCTTC CTCCGCGCGA AGCCGCCGTC GCGCACCCAC
TGGGTCATGC ACGAGTACCG CCTCGCCGCC GCCGGCGCTG TCGCCGTCGC CGCCGCCGGA CAGACAAAGC GCGGGAACCA
TGTGAGTCTG AATTCTCCAA TTCTTCAGTA ATAACACTAA TAGTACTGAT ACATGTGATT AAGTCTAATG TCATTCTGAA
TCATCATTAG GTTTTGCTTC AAAGGTTCAA ATTAATTAAC CCCAGTTTTA GTTCAAACTT TTATTAGAAC AAACTTAGCA
TATGTATGTG AAATTTTTGG GTAAATTAAC TGAAGAGAAG TTTGCAGCTT TTGCAAAAGG CTTTCCACAG CGCACGGCAG
CATCTCAATC ATGCAGACAT GAGAGAATCT TTGCCTCCTT TCAAAGTAAC TTAACCTGCT TGGCTACGTG GATTAGGACA
CTTCACTGTG TGCGGCCACT TGTCTTGCAT TGTGTTCCAT CAAAAAATTT AATTGAACCT CTTTGTCACT CACATCTCAT
CTACTAGCAT GCACCCGTCG CTGTAAATTT AAACACGAAT TCAGTTCAGT TCAGACTTGA GAGCTCAATT TGATCATCTG
GAATCTGATG AATGGTATCA TTATGTTTTT CTTTGCAGAG TTGCATGGCT CAGCCAGGAG AATGGGTGGT GTGCCGGATT
TTTCTGAAGA ACAACAGGTC ATCAAGAAGG CGAGCCGGCG ACGCCGACGG CGAAACGCCG GTCACCGGTG TCCACGGTCA
CCGTCGGCGG CAGCCGTCGC CGTCGCCGTC GTCGTCGAGC TGTGTCACGG CTGAGGTTTC AGACGGAGAA GGAGAAGAAG
AAGTCAGCAG TGGCAGCATC AATGGTGCTC CATCTGCCTC TCAAAGAGAG GCCTAGACAT GCTGAAAATC TCCTTAATTA
ATTACTAGTA CTAGTGATTT TTTTTCTTCT TCTTCTTGTT CTCTTTTGTC CCTCCATTGC TTTTCCTGTA CTTCTCCTTG
TACCATAATG ATTAGTAGGA GTTTAAGTTT AAGCAGCAGG TTGAAGAGAG AAGCCCCAGC TTAAGAAAGC TCCTAAGTAA
AGATTACTGA GCAGCAGCTG TGACATCTGT ATCAATTGTA ACTTGTAAGT TTCTCTTGAT CATTTATTAA GATAAGGAAC
CTCAATTAAG CAGG

Locus: Os09g0509100

Loading...

Locus: Os09g0509100

Loading...