Os09t0511600-01

Locus

Os09g0511600

Description

Transglucosidase

RAP-DB Gene Symbol Synonym(s)

Os9BGlu31

RAP-DB Gene Name Synonym(s)

beta-glucosidase 31

CGSNL Gene Symbol

BGLU31

CGSNL Gene Name

BETA-GLUCOSIDASE 31

Oryzabase Gene Symbol Synonym(s)

Os9bglu31, Os9BGlu31

Oryzabase Gene Name Synonym(s)

beta-glucosidase 31

Transcript Evidence

AK121935

Protein Evidence

B7F7K7

Literature

PMID: 23430256

Note

Manual Curation

July 30, 2020

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase superfamily (IPR017853)

Glycoside hydrolase family 1 (IPR001360)

Glycosyl hydrolases family 1, N-terminal conserved site (IPR033132)

Experimentally confirmed subcellular location

vacuole (GO:0005773)

Full-length cDNA

J033107A08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0511600-01)

RiceXPro (AK121935)

Others

Oryzabase (12104)

KEGG (Os09t0511600-01)

Transcript

2095 bp

>Os09t0511600-01 Transglucosidase
GGTGGAAAACGCCCACTTCGCCACCGCTCGCGCGCGCACGCCCACGCCGCTCCTCCCCTC
CCCTCCCCCGCCTCCGTATAAAGCCGCGCCCGCGCCGCGCACGCCGGCCGGCCACCGAGG
ACGAGCTAGAGCGCGCGCGCCGCCGCGAAACATTAGCTATAGCTAGCTAGATATAGCCGG
CCGGCGATCGAGGAGATCGATCGATCGAACGCCGCCGCGCGCGCGCGGTCATGACGCCGG
CGAGGGTGGTGTTCATCTGCTGCGTTGTTCTGCTCGCCGCCGCCGCCGCGGCGGCGTCGT
CGTCGACGGCGGCGGGGATCACCAGGGCCGACTTCCCGCCGGAGTTCATCTTCGGCGCCG
GCTCCTCCGCTTATCAGGTTGAAGGTGCATTTGCAGAGGATGGAAGAAAGCCTAGTATCT
GGGACACGTTTTCGCACTCAGGCTATTCTGTTGATGGAGCAACCGGTGATGTAACTGCAG
ATCAGTATCATAAGTACAAGGCAAATGTAAAGCTTTTGCAAGACATGGGCGTTGACGCGT
ACAGGATGTCCATTTCTTGGTCTCGGCTTATTCCTGATGGGCGAGGAGCTGTCAATCCGA
AGGGACTGGAATACTATAACAACCTGATTGATGAACTTCTGAGCCATGGAATCCAACCTC
ACGTAACGATATATCATTTCGATTTTCCTCAGGCTCTCCAAGATGAATACAATGGGATAC
TTAGTCCTAGATTTGTAGAGGACTTCACAGCATACGCGGATGTCTGCTTCAAGAACTTTG
GTGATAGAGTGAAGCACTGGAGCACTGTCAATGAGCCTAACATCGAGCCGATTGGCGGAT
ACGATCAAGGAATCCTTCCGCCACGGCGATGCTCATTCCCCTTTGGTGTCCTCAGTTGTG
ACAATGGCAACTCTACCACAGAGCCATACATAGTAGCACATCATCTTCTTCTTGCACATT
CCTCAGCAGTGTCCCTCTACAGAGAGAAGTACCAGGCCACTCAAGGAGGACAAATTGGGC
TCACATTGCTCGGTTGGTGGTACGAGCCCGGGACGCAAGATCCTGAAGATGTAGCAGCAG
CTGCAAGGATGAATGATTTCCACATTGGATGGTACATGCATCCTTTGGTGTACGGTGACT
ACCCTCCGGTAATGAGGAAGAATGTTGGGTCCAGGCTACCATCTTTCACAGCTGAAGAAT
CAAAGAGAGTACTTGAATCCTATGATTTTGTCGGATTTAACCACTATGTCGCCATTTTTG
TGAGAGCCGACCTTAGCAAACTTGATCAGAGCCTCAGAGATTACATGGGCGATGCAGCTG
TCAAATATGACCTCCCATTCCTGAAATCAAATAATGAGTTCCCACTCGGGTTGACGAGTG
ACTTCATGACGTCGACCCCATGGGCTCTGAAGAAGATGCTCAATCATCTCCAAGAGAAGT
ACAAGAACCCTATTGTCATGATCCATGAGAATGGAGCCGCTGGGCAGCCTGACCCTTCAG
GCGGAAACACCTACGACGACGATTTCAGGTCGCAATATCTGCAGGATTACATCGAGGCCA
CACTTCAATCCATCAGGAACGGGTCGAACGTGCAGGGCTACTTCGTGTGGTCGTTCCTGG
ACGTGTTCGAGTACCTGTTCGGCTACCGCCTCCGCTTCGGCCTCTACGGCGTCGACTTCG
CCTCGCCGGAGAGGACCAGGTACCAGAGGCACTCGGCGCGGTGGTACGCCGGCTTCCTCC
GCGGCGGCGAGCTCCGGCCGGCGGCGGCGGCGCTGGCCGGCGGCGGAGCCTACTCCCAGT
GATCAAGGTTCTTCTTCCTCGCACGCTTTCATCTCGCGAAGAACAGGACAGGACGGGACA
ATAAAATTTACCTGGATAGATACAGAAGAATTATACAGTTCATATGGAAGTTGATCTTTT
GAATAGGGTCTTAGAATGAATGGTCTCTCTTCTTCCCCTGGTTTTTGGTTCTTCTGTTTA
CAGACCAATGATGGGTCAATGTCAGTCAAATTGTGTGATTTAGATCAATGGGTCAAAGTG
TATGATGTGATTGTGTAATTGTGTCGATTATATATAAAATTTTGAAGTCTCTCGT

CDS

1572 bp

>Os09t0511600-01 Transglucosidase
ATGACGCCGGCGAGGGTGGTGTTCATCTGCTGCGTTGTTCTGCTCGCCGCCGCCGCCGCG
GCGGCGTCGTCGTCGACGGCGGCGGGGATCACCAGGGCCGACTTCCCGCCGGAGTTCATC
TTCGGCGCCGGCTCCTCCGCTTATCAGGTTGAAGGTGCATTTGCAGAGGATGGAAGAAAG
CCTAGTATCTGGGACACGTTTTCGCACTCAGGCTATTCTGTTGATGGAGCAACCGGTGAT
GTAACTGCAGATCAGTATCATAAGTACAAGGCAAATGTAAAGCTTTTGCAAGACATGGGC
GTTGACGCGTACAGGATGTCCATTTCTTGGTCTCGGCTTATTCCTGATGGGCGAGGAGCT
GTCAATCCGAAGGGACTGGAATACTATAACAACCTGATTGATGAACTTCTGAGCCATGGA
ATCCAACCTCACGTAACGATATATCATTTCGATTTTCCTCAGGCTCTCCAAGATGAATAC
AATGGGATACTTAGTCCTAGATTTGTAGAGGACTTCACAGCATACGCGGATGTCTGCTTC
AAGAACTTTGGTGATAGAGTGAAGCACTGGAGCACTGTCAATGAGCCTAACATCGAGCCG
ATTGGCGGATACGATCAAGGAATCCTTCCGCCACGGCGATGCTCATTCCCCTTTGGTGTC
CTCAGTTGTGACAATGGCAACTCTACCACAGAGCCATACATAGTAGCACATCATCTTCTT
CTTGCACATTCCTCAGCAGTGTCCCTCTACAGAGAGAAGTACCAGGCCACTCAAGGAGGA
CAAATTGGGCTCACATTGCTCGGTTGGTGGTACGAGCCCGGGACGCAAGATCCTGAAGAT
GTAGCAGCAGCTGCAAGGATGAATGATTTCCACATTGGATGGTACATGCATCCTTTGGTG
TACGGTGACTACCCTCCGGTAATGAGGAAGAATGTTGGGTCCAGGCTACCATCTTTCACA
GCTGAAGAATCAAAGAGAGTACTTGAATCCTATGATTTTGTCGGATTTAACCACTATGTC
GCCATTTTTGTGAGAGCCGACCTTAGCAAACTTGATCAGAGCCTCAGAGATTACATGGGC
GATGCAGCTGTCAAATATGACCTCCCATTCCTGAAATCAAATAATGAGTTCCCACTCGGG
TTGACGAGTGACTTCATGACGTCGACCCCATGGGCTCTGAAGAAGATGCTCAATCATCTC
CAAGAGAAGTACAAGAACCCTATTGTCATGATCCATGAGAATGGAGCCGCTGGGCAGCCT
GACCCTTCAGGCGGAAACACCTACGACGACGATTTCAGGTCGCAATATCTGCAGGATTAC
ATCGAGGCCACACTTCAATCCATCAGGAACGGGTCGAACGTGCAGGGCTACTTCGTGTGG
TCGTTCCTGGACGTGTTCGAGTACCTGTTCGGCTACCGCCTCCGCTTCGGCCTCTACGGC
GTCGACTTCGCCTCGCCGGAGAGGACCAGGTACCAGAGGCACTCGGCGCGGTGGTACGCC
GGCTTCCTCCGCGGCGGCGAGCTCCGGCCGGCGGCGGCGGCGCTGGCCGGCGGCGGAGCC
TACTCCCAGTGA

Protein

524 aa

>Os09t0511600-01 Transglucosidase
MTPARVVFICCVVLLAAAAAAASSSTAAGITRADFPPEFIFGAGSSAYQVEGAFAEDGRK
PSIWDTFSHSGYSVDGATGDVTADQYHKYKANVKLLQDMGVDAYRMSISWSRLIPDGRGA
VNPKGLEYYNNLIDELLSHGIQPHVTIYHFDFPQALQDEYNGILSPRFVEDFTAYADVCF
KNFGDRVKHWSTVNEPNIEPIGGYDQGILPPRRCSFPFGVLSCDNGNSTTEPYIVAHHLL
LAHSSAVSLYREKYQATQGGQIGLTLLGWWYEPGTQDPEDVAAAARMNDFHIGWYMHPLV
YGDYPPVMRKNVGSRLPSFTAEESKRVLESYDFVGFNHYVAIFVRADLSKLDQSLRDYMG
DAAVKYDLPFLKSNNEFPLGLTSDFMTSTPWALKKMLNHLQEKYKNPIVMIHENGAAGQP
DPSGGNTYDDDFRSQYLQDYIEATLQSIRNGSNVQGYFVWSFLDVFEYLFGYRLRFGLYG
VDFASPERTRYQRHSARWYAGFLRGGELRPAAAALAGGGAYSQ*

5'UTR

chr09:19887895..19888124 (- strand) : 230 bp

CDS

chr09:19887748..19887894 (- strand) : 147 bp

chr09:19885812..19885875 (- strand) : 64 bp

chr09:19885647..19885709 (- strand) : 63 bp

chr09:19885467..19885538 (- strand) : 72 bp

chr09:19885302..19885373 (- strand) : 72 bp

chr09:19885118..19885205 (- strand) : 88 bp

chr09:19884761..19885019 (- strand) : 259 bp

chr09:19884559..19884674 (- strand) : 116 bp

chr09:19884244..19884464 (- strand) : 221 bp

chr09:19884127..19884152 (- strand) : 26 bp

chr09:19883875..19883989 (- strand) : 115 bp

chr09:19883489..19883591 (- strand) : 103 bp

chr09:19883009..19883234 (- strand) : 226 bp

3'UTR

chr09:19882716..19883008 (- strand) : 293 bp

FASTA

>Os09t0511600-01 class=Sequence position=chr09:19882716..19888124 (- strand)
GGTGGAAAAC GCCCACTTCG CCACCGCTCG CGCGCGCACG CCCACGCCGC TCCTCCCCTC CCCTCCCCCG CCTCCGTATA
AAGCCGCGCC CGCGCCGCGC ACGCCGGCCG GCCACCGAGG ACGAGCTAGA GCGCGCGCGC CGCCGCGAAA CATTAGCTAT
AGCTAGCTAG ATATAGCCGG CCGGCGATCG AGGAGATCGA TCGATCGAAC GCCGCCGCGC GCGCGCGGTC ATGACGCCGG
CGAGGGTGGT GTTCATCTGC TGCGTTGTTC TGCTCGCCGC CGCCGCCGCG GCGGCGTCGT CGTCGACGGC GGCGGGGATC
ACCAGGGCCG ACTTCCCGCC GGAGTTCATC TTCGGCGCCG GCTCCTCCGC TTATCAGGTA GACACGTTTT TTTTCCCTTT
TTTAGCGCGA ACTCAACCAC CAAGCAAACC TGATCACTGC CGATGCATGC ACAGTGCACA CACATCTATC TCTTGCTCTA
CAAATCATGC AAAAAAGAAG GAAAAAACAA AACTGTAACT AGATACAAAT CGGATGGAGT TGAATCTGTT GCACAAATTA
ATTCGAAACA TTAATTATAT TTCTCGCATC ATCGATTTGC TCGTTAGAAT ATCAGAGAGT ACAAAATTTT ACTGTCAACG
CCTGTCCAAG ACTGCAACCT GTTCGTCGGT ATGTCCAACC GCCACACTAT CTCGTTCGCT ATTCCTGTCC ATGTGTTCCC
CCTGACTAAC ACGAACCATA CAAAATAACA ATATAAAATT CGTCGATTCA ACGAGCACAT TCGTTGTGCC CTTTGTTCAA
TTCTTGGATA AAAACAGACG GATGAAATTC AGAGTGACTT TTTTGTTAAC CTCTCGCTTT CCTACTGAAC TTTAATCACA
GAAGTAGGCT TTGCTTCTTT CTTCGTTTAA CCTTTGTGCT AACCAGTGTC ACTCTCTTTA TGACTTGTTG TTTCACGTTA
GTACTCTGGT AATATGCAAT ATATGTCGGT ATGCAAGAAA TTCATTGCAT CGACGCAACA TTTCAGTACT TGTTCCGTCT
GTGGTTAACT GTTCAGCTGT TCTTTAGCTT TGTTTTGTAC TTAAGAGAGT ACAAATTGTG AACTGGTGAT ACACTGATAC
TAAAACTCCT AAAAGTCCCG GTTTTGCTTG CTTATGTCAT GGCTAGTCCA AATTCAGCCA TCATAATAAC CTTTTGCACA
AAGCAAGGGC ATAACTCCAC AAGAGTCAGT GTGCCTGACG AGCCGATTAA TTATACCTGG TACAATTTAT ATTCAAGTAT
TGTTCGATAG GAAATATGTA CTTATTAGGC ACTGCAAATT GGTAGGAGAA TTATTGAAAG CTGTAAGATA TTGTCTTCTA
CACCAACTTG GCTCCGAGAA ACATAAGAAA AGCCGGCGCT GCATAAGTCA ATTTCCCCAA GTACTAGTCC ATGCATCTGG
CTTAGTTTAA TCTGCTAGCC GACACCTTGT TCTTATTGTT TTTCTCGAAA AAAGAATTGC TAGCTCTTCT GGAATCGGTG
CCCTATTTTC CATTTTTACT GATTTCATGT TGCGAATTGT GATGATTCCT TGGTCCTTTG GTCACCGCTA ACCTGCAAGC
AGAAACAATC AAACAACGCT CACCGAATAC GACTCTCGGC GATTGGTGGC CTCTAGTGCA CAATCTTGCT TTGTTTCTGA
CGAAGATGTG TTTGTTTCCA TCGTCTTCCA CTAGGAACAA AAAACCATAC ATGTCGTTTT CTTTCCGGTG TCACTTGAAT
GGTCTTTTCT GCATCTTCCG TTTGGCATCT TGCCTTTAGA GAGAGTGCAT AAGTGTATCT TGCTAAGTAC AAGTCGCAGT
GGAGGCCTGA CATTTGGCAG ATTCAGAGAA ATGCATGGCC TGAAACCTAT GTTGTTAGAA CAGGGAAAAG TTGTGGTGAG
GTGAGATCAG TAGATGTTAC TATCGTTGCT TTCAGCTGAG TTGGTGGTAA GGAATTGGGG AAAATGCATT TTGCCAAATA
AGTCAGATGT GTACTTTGAT TTGATTCTCT GAGGGAAAAT TAGTAATCGC ACTGCATTAG TAGTCATGCA GCAATTTCAG
TATATTGGTT ACAGGTAGAA AATAATTAGC ATCATAGTAC CCTCATTGAT AAGGTTGTGA ACGTTCAAAA TGGTGCATCA
TAAAAACTTA TGCTACTCGA CATGTTGATC AAGATTTGGA GTGTTGTATA GCATATTGTA CTGACCTGAA CATTCACAAA
ATTGCTTAGG TTGAAGGTGC ATTTGCAGAG GATGGAAGAA AGCCTAGTAT CTGGGACACG TTTTCGCACT CAGGTTAGTT
TGGTCTAAGA TTTACTTGTG AAAATTGAGT CTGTGTCTAC GATAAATTTC AAATTCTTAA AATTAACGAG AACTTTCTAA
TTCTATTTTC CACAGGCTAT TCTGTTGATG GAGCAACCGG TGATGTAACT GCAGATCAGT ATCATAAGTA CAAGGCAAGT
TCTTGGGACA GTTCTGGTTA AGGTTTTTTT TTTCAGATTA CGAGCATGTC AATTTCTGAA GATGTAAAGC TTTTGCAATA
ACAAATATGT CTTTGATAAC AGGAAGATGT AAAGCTTTTG CAAGACATGG GCGTTGACGC GTACAGGATG TCCATTTCTT
GGTCTCGGCT TATTCCTGGT GAGTTTACGC TAATAGTATT ACTGCATGTT CAGAAGTGTG CATAAGAAAA ATCAGCTGAA
AGTTGACTGA TTTGGTTGCT TGTACATGTA GATGGGCGAG GAGCTGTCAA TCCGAAGGGA CTGGAATACT ATAACAACCT
GATTGATGAA CTTCTGAGCC ATGGTATGTA AATGTAATCC CTTTATCTGA ACTGTTACTA ATTTTGCAAT GCTGAAATAT
GAGGATAATA TTTTATCCAT GTTTTTTGTG TTTATGTAGG AATCCAACCT CACGTAACGA TATATCATTT CGATTTTCCT
CAGGCTCTCC AAGATGAATA CAATGGGATA CTTAGTCCTA GATTTGTGTA CTTTCTTGCT ACCCCCCTAA GCCTTACCCC
CTTACTGCAA TTGCTTCCAT ATGAACTGAA ATAATATTGC TTTTGCATTC TTGGCCATGA TGTAGAGAGG ACTTCACAGC
ATACGCGGAT GTCTGCTTCA AGAACTTTGG TGATAGAGTG AAGCACTGGA GCACTGTCAA TGAGCCTAAC ATCGAGCCGA
TTGGCGGATA CGATCAAGGA ATCCTTCCGC CACGGCGATG CTCATTCCCC TTTGGTGTCC TCAGTTGTGA CAATGGCAAC
TCTACCACAG AGCCATACAT AGTAGCACAT CATCTTCTTC TTGCACATTC CTCAGCAGTG TCCCTCTACA GAGAGAAGTA
CCAGGTCTGA AATTAATGCC ATCTTCTCTT ACAGAAGGAC CGATGATCAT CTTCAGATAT AGAATCTAAC CTTTGTCTAT
TGCTTATCAG GCCACTCAAG GAGGACAAAT TGGGCTCACA TTGCTCGGTT GGTGGTACGA GCCCGGGACG CAAGATCCTG
AAGATGTAGC AGCAGCTGCA AGGATGAATG ATTTCCACAT TGGATGGTTT GTTATGCTCC AAGTCTAGAC TTCAAGTTTC
ACAAAAACAC CTGAAGTTTT TCATGTACCT TACATGTAAG ATCATGTGTT TTTGGCTCAG GTACATGCAT CCTTTGGTGT
ACGGTGACTA CCCTCCGGTA ATGAGGAAGA ATGTTGGGTC CAGGCTACCA TCTTTCACAG CTGAAGAATC AAAGAGAGTA
CTTGAATCCT ATGATTTTGT CGGATTTAAC CACTATGTCG CCATTTTTGT GAGAGCCGAC CTTAGCAAAC TTGATCAGAG
CCTCAGAGAT TACATGGGCG ATGCAGCTGT CAAATATGAC CGTAAGTGTC CTAATGACAT CAAATCTTAG TACGTCTCAC
AATATAACAA CAGATAATTT AATTTTTCTA CACTTCTTTT GTTCTTTTGC AGTCCCATTC CTGAAATCAA ATAATGAGGT
ATTCGGTGAC ATAACTTGCT CTTGTGAAAT TATACTGTCT GTCTCTGAAT TTAGTGCCAG ACTGCCAGTA CCTCCATCAT
GGCTAAAGCA TTTCTCCTTT TTTTTTCTGA TGGTGAAAAA ACTGAACAAT AACAGTTCCC ACTCGGGTTG ACGAGTGACT
TCATGACGTC GACCCCATGG GCTCTGAAGA AGATGCTCAA TCATCTCCAA GAGAAGTACA AGAACCCTAT TGTCATGATC
CATGAGAATG GTAACATCAC CTGAAACACT GCCAACAACA GAGCATCAAC TGATCAAACA GTTTTACACT TTTACTGCAA
CAATCACACT GCCAAGATGA TTGAATCATC AGCTGATAAA CAGTCTTACT GCAACAATCA CACTACCAAA ATGATTGAAT
CGTCAACTGA TCAACCGTTT TACTGCAACA GTCACACTGC CAACAATAAA TCATCAATTG ATCAACAGTT TTACTGCATC
AGTTCAGATA TAATATATAC TCACTCTCTG CTACATTGGC CATGCTTTTT CAGGAGCCGC TGGGCAGCCT GACCCTTCAG
GCGGAAACAC CTACGACGAC GATTTCAGGT CGCAATATCT GCAGGATTAC ATCGAGGCCA CACTTCAATC CATCAGGTAT
ATGCTTTTTT CTTTTACATA ATATAAGCTT TATTAAACCC ATCCAATTAC ACTAAGTGAT ACAACCGTAC CGAGAAAATT
TCTCGGTCGG ATTCATTTTT TTATTAAAAA ATTCGTGTTG AAATTTGAAA TTTTGTTTGA ACCGAGCAAT AAAACCCTCA
AAGAAATTTC TCTATTGGAT TCAATTTCTT TTTTATTTTT TTTCAAAAAA TCGTGTTGAA ATTTGAAATA TTTGTTTGAA
CCGAGTGCAG GAACGGGTCG AACGTGCAGG GCTACTTCGT GTGGTCGTTC CTGGACGTGT TCGAGTACCT GTTCGGCTAC
CGCCTCCGCT TCGGCCTCTA CGGCGTCGAC TTCGCCTCGC CGGAGAGGAC CAGGTACCAG AGGCACTCGG CGCGGTGGTA
CGCCGGCTTC CTCCGCGGCG GCGAGCTCCG GCCGGCGGCG GCGGCGCTGG CCGGCGGCGG AGCCTACTCC CAGTGATCAA
GGTTCTTCTT CCTCGCACGC TTTCATCTCG CGAAGAACAG GACAGGACGG GACAATAAAA TTTACCTGGA TAGATACAGA
AGAATTATAC AGTTCATATG GAAGTTGATC TTTTGAATAG GGTCTTAGAA TGAATGGTCT CTCTTCTTCC CCTGGTTTTT
GGTTCTTCTG TTTACAGACC AATGATGGGT CAATGTCAGT CAAATTGTGT GATTTAGATC AATGGGTCAA AGTGTATGAT
GTGATTGTGT AATTGTGTCG ATTATATATA AAATTTTGAA GTCTCTCGT

Locus: Os09g0511600

Loading...

Locus: Os09g0511600

Loading...