Os09t0511600-03

Locus

Os09g0511600

Description

Glycoside hydrolase, family 1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BGLU31

CGSNL Gene Name

BETA-GLUCOSIDASE 31

Oryzabase Gene Symbol Synonym(s)

Os9bglu31, Os9BGlu31

Oryzabase Gene Name Synonym(s)

beta-glucosidase 31

Transcript Evidence

AK121679 (DDBJ, Best hit)

Protein Evidence

B7F7K7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 1 (IPR001360)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Glycoside hydrolase, superfamily (IPR017853)

Glycoside hydrolase, family 1, active site (IPR018120)

Full-length cDNA

J033069H08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0511600-03)

Others

Oryzabase (12104)

Transcript

2058 bp

>Os09t0511600-03 Glycoside hydrolase, family 1 protein.
ACGCCGCTCCTCCCCTCCCCTCCCCCGCCTCCGTATAAAGCCGCGCCCGCGCCGCGCACG
CCGGCCGGCCACCGAGGACGAGCTAGAGCGCGCGCGCCGCCGCGAAACATTAGCTATAGC
TAGCTAGATATAGCCGGCCGGCGATCGAGGAGATCGATCGATCGAACGCCGCCGCGCGCG
CGCGGTCATGACGCCGGCGAGGGTGGTGTTCATCTGCTGCGTTGTTCTGCTCGCCGCCGC
CGCCGCGGCGGCGTCGTCGTCGACGGCGGCGGGGATCACCAGGGCCGACTTCCCGCCGGA
GTTCATCTTCGGCGCCGGCTCCTCCGCTTATCAGGTTGAAGGTGCATTTGCAGAGGATGG
AAGAAAGCCTAGTATCTGGGACACGTTTTCGCACTCAGGCTATTCTGTTGATGGAGCAAC
CGGTGATGTAACTGCAGATCAGTATCATAAGTACAAGGCAAATGTAAAGCTTTTGCAAGA
CATGGGCGTTGACGCGTACAGGATGTCCATTTCTTGGTCTCGGCTTATTCCTGATGGGCG
AGGAGCTGTCAATCCGAAGGGACTGGAATACTATAACAACCTGATTGATGAACTTCTGAG
CCATGGAATCCAACCTCACGTAACGATATATCATTTCGATTTTCCTCAGGCTCTCCAAGA
TGAATACAATGGGATACTTAGTCCTAGATTTGTAGAGGACTTCACAGCATACGCGGATGT
CTGCTTCAAGAACTTTGGTGATAGAGTGAAGCACTGGAGCACTGTCAATGAGCCTAACAT
CGAGCCGATTGGCGGATACGATCAAGGAATCCTTCCGCCACGGCGATGCTCATTCCCCTT
TGGTGTCCTCAGTTGTGACAATGGCAACTCTACCACAGAGCCATACATAGTAGCACATCA
TCTTCTTCTTGCACATTCCTCAGCAGTGTCCCTCTACAGAGAGAAGTACCAGGCCACTCA
AGGAGGACAAATTGGGCTCACATTGCTCGGTTGGTGGTACGAGCCCGGGACGCAAGATCC
TGAAGATGTAGCAGCAGCTGCAAGGATGAATGATTTCCACATTGGATGGTACATGCATCC
TTTGGTGTACGGTGACTACCCTCCGGTAATGAGGAAGAATGTTGGGTCCAGGCTACCATC
TTTCACAGCTGAAGAATCAAAGAGAGTACTTGAATCCTATGATTTTGTCGGATTTAACCA
CTATGTCGCCATTTTTGTGAGAGCCGACCTTAGCAAACTTGATCAGAGCCTCAGAGATTA
CATGGGCGATGCAGCTGTCAAATATGACCTCCCATTCCTGAAATCAAATAATGAGTTCCC
ACTCGGGTTGACGAGTGACTTCATGACGTCGACCCCATGGGCTCTGAAGAAGATGCTCAA
TCATCTCCAAGAGAAGTACAAGAACCCTATTGTCATGATCCATGAGAATGGAGCCGCTGG
GCAGCCTGACCCTTCAGGCGGAAACACCTACGACGACGATTTCAGGTCGCAATATCTGCA
GGATTACATCGAGGCCACACTTCAATCCATCAGGAACGGGTCGAACGTGCAGGGCTACTT
CGTGTGGTCGTTCCTGGACGTGTTCGAGTACCTGTTCGGCTACCGCCTCCGCTTCGGCCT
CTACGGCGTCGACTTCGCCTCGCCGGAGAGGACCAGGTACCAGAGGCACTCGGCGCGGTG
GTACGCCGGCTTCCTCCGCGGCGGCGAGCTCCGGCCGGCGGCGGCGGCGCTGGCCGGCGG
CGGAGCCTACTCCCAGTGATCAAGGTTCTTCTTCCTCGCACGCTTTCATCTCGCGAAGAA
CAGGACAGGACGGGACAATAAAATTTACCTGGATAGATACAGAAGAATTATACAGTTCAT
ATGGAAGTTGATCTTTTGAATAGGGTCTTAGAATGAATGGTCTCTCTTCTTCCCCTGGTT
TTTGGTTCTTCTGTTTACAGACCAATGATGGGTCAATGTCAGTCAAATTGTGTGATTTAG
ATCAATGGGTCAAAGTGTATGATGTGATTGTGTAATTGTGTCGATTATATATAAAATTTT
GAAGTCTCTCGTAGTTTG

CDS

1572 bp

>Os09t0511600-03 Glycoside hydrolase, family 1 protein.
ATGACGCCGGCGAGGGTGGTGTTCATCTGCTGCGTTGTTCTGCTCGCCGCCGCCGCCGCG
GCGGCGTCGTCGTCGACGGCGGCGGGGATCACCAGGGCCGACTTCCCGCCGGAGTTCATC
TTCGGCGCCGGCTCCTCCGCTTATCAGGTTGAAGGTGCATTTGCAGAGGATGGAAGAAAG
CCTAGTATCTGGGACACGTTTTCGCACTCAGGCTATTCTGTTGATGGAGCAACCGGTGAT
GTAACTGCAGATCAGTATCATAAGTACAAGGCAAATGTAAAGCTTTTGCAAGACATGGGC
GTTGACGCGTACAGGATGTCCATTTCTTGGTCTCGGCTTATTCCTGATGGGCGAGGAGCT
GTCAATCCGAAGGGACTGGAATACTATAACAACCTGATTGATGAACTTCTGAGCCATGGA
ATCCAACCTCACGTAACGATATATCATTTCGATTTTCCTCAGGCTCTCCAAGATGAATAC
AATGGGATACTTAGTCCTAGATTTGTAGAGGACTTCACAGCATACGCGGATGTCTGCTTC
AAGAACTTTGGTGATAGAGTGAAGCACTGGAGCACTGTCAATGAGCCTAACATCGAGCCG
ATTGGCGGATACGATCAAGGAATCCTTCCGCCACGGCGATGCTCATTCCCCTTTGGTGTC
CTCAGTTGTGACAATGGCAACTCTACCACAGAGCCATACATAGTAGCACATCATCTTCTT
CTTGCACATTCCTCAGCAGTGTCCCTCTACAGAGAGAAGTACCAGGCCACTCAAGGAGGA
CAAATTGGGCTCACATTGCTCGGTTGGTGGTACGAGCCCGGGACGCAAGATCCTGAAGAT
GTAGCAGCAGCTGCAAGGATGAATGATTTCCACATTGGATGGTACATGCATCCTTTGGTG
TACGGTGACTACCCTCCGGTAATGAGGAAGAATGTTGGGTCCAGGCTACCATCTTTCACA
GCTGAAGAATCAAAGAGAGTACTTGAATCCTATGATTTTGTCGGATTTAACCACTATGTC
GCCATTTTTGTGAGAGCCGACCTTAGCAAACTTGATCAGAGCCTCAGAGATTACATGGGC
GATGCAGCTGTCAAATATGACCTCCCATTCCTGAAATCAAATAATGAGTTCCCACTCGGG
TTGACGAGTGACTTCATGACGTCGACCCCATGGGCTCTGAAGAAGATGCTCAATCATCTC
CAAGAGAAGTACAAGAACCCTATTGTCATGATCCATGAGAATGGAGCCGCTGGGCAGCCT
GACCCTTCAGGCGGAAACACCTACGACGACGATTTCAGGTCGCAATATCTGCAGGATTAC
ATCGAGGCCACACTTCAATCCATCAGGAACGGGTCGAACGTGCAGGGCTACTTCGTGTGG
TCGTTCCTGGACGTGTTCGAGTACCTGTTCGGCTACCGCCTCCGCTTCGGCCTCTACGGC
GTCGACTTCGCCTCGCCGGAGAGGACCAGGTACCAGAGGCACTCGGCGCGGTGGTACGCC
GGCTTCCTCCGCGGCGGCGAGCTCCGGCCGGCGGCGGCGGCGCTGGCCGGCGGCGGAGCC
TACTCCCAGTGA

Protein

524 aa

>Os09t0511600-03 Glycoside hydrolase, family 1 protein.
MTPARVVFICCVVLLAAAAAAASSSTAAGITRADFPPEFIFGAGSSAYQVEGAFAEDGRK
PSIWDTFSHSGYSVDGATGDVTADQYHKYKANVKLLQDMGVDAYRMSISWSRLIPDGRGA
VNPKGLEYYNNLIDELLSHGIQPHVTIYHFDFPQALQDEYNGILSPRFVEDFTAYADVCF
KNFGDRVKHWSTVNEPNIEPIGGYDQGILPPRRCSFPFGVLSCDNGNSTTEPYIVAHHLL
LAHSSAVSLYREKYQATQGGQIGLTLLGWWYEPGTQDPEDVAAAARMNDFHIGWYMHPLV
YGDYPPVMRKNVGSRLPSFTAEESKRVLESYDFVGFNHYVAIFVRADLSKLDQSLRDYMG
DAAVKYDLPFLKSNNEFPLGLTSDFMTSTPWALKKMLNHLQEKYKNPIVMIHENGAAGQP
DPSGGNTYDDDFRSQYLQDYIEATLQSIRNGSNVQGYFVWSFLDVFEYLFGYRLRFGLYG
VDFASPERTRYQRHSARWYAGFLRGGELRPAAAALAGGGAYSQ*

5'UTR

chr09:19887895..19888081 (- strand) : 187 bp

CDS

chr09:19887748..19887894 (- strand) : 147 bp

chr09:19885812..19885875 (- strand) : 64 bp

chr09:19885647..19885709 (- strand) : 63 bp

chr09:19885467..19885538 (- strand) : 72 bp

chr09:19885302..19885373 (- strand) : 72 bp

chr09:19885118..19885205 (- strand) : 88 bp

chr09:19884761..19885019 (- strand) : 259 bp

chr09:19884559..19884674 (- strand) : 116 bp

chr09:19884244..19884464 (- strand) : 221 bp

chr09:19884127..19884152 (- strand) : 26 bp

chr09:19883875..19883989 (- strand) : 115 bp

chr09:19883489..19883591 (- strand) : 103 bp

chr09:19883009..19883234 (- strand) : 226 bp

3'UTR

chr09:19882710..19883008 (- strand) : 299 bp

FASTA

>Os09t0511600-03 class=Sequence position=chr09:19882710..19888081 (- strand)
ACGCCGCTCC TCCCCTCCCC TCCCCCGCCT CCGTATAAAG CCGCGCCCGC GCCGCGCACG CCGGCCGGCC ACCGAGGACG
AGCTAGAGCG CGCGCGCCGC CGCGAAACAT TAGCTATAGC TAGCTAGATA TAGCCGGCCG GCGATCGAGG AGATCGATCG
ATCGAACGCC GCCGCGCGCG CGCGGTCATG ACGCCGGCGA GGGTGGTGTT CATCTGCTGC GTTGTTCTGC TCGCCGCCGC
CGCCGCGGCG GCGTCGTCGT CGACGGCGGC GGGGATCACC AGGGCCGACT TCCCGCCGGA GTTCATCTTC GGCGCCGGCT
CCTCCGCTTA TCAGGTAGAC ACGTTTTTTT TCCCTTTTTT AGCGCGAACT CAACCACCAA GCAAACCTGA TCACTGCCGA
TGCATGCACA GTGCACACAC ATCTATCTCT TGCTCTACAA ATCATGCAAA AAAGAAGGAA AAAACAAAAC TGTAACTAGA
TACAAATCGG ATGGAGTTGA ATCTGTTGCA CAAATTAATT CGAAACATTA ATTATATTTC TCGCATCATC GATTTGCTCG
TTAGAATATC AGAGAGTACA AAATTTTACT GTCAACGCCT GTCCAAGACT GCAACCTGTT CGTCGGTATG TCCAACCGCC
ACACTATCTC GTTCGCTATT CCTGTCCATG TGTTCCCCCT GACTAACACG AACCATACAA AATAACAATA TAAAATTCGT
CGATTCAACG AGCACATTCG TTGTGCCCTT TGTTCAATTC TTGGATAAAA ACAGACGGAT GAAATTCAGA GTGACTTTTT
TGTTAACCTC TCGCTTTCCT ACTGAACTTT AATCACAGAA GTAGGCTTTG CTTCTTTCTT CGTTTAACCT TTGTGCTAAC
CAGTGTCACT CTCTTTATGA CTTGTTGTTT CACGTTAGTA CTCTGGTAAT ATGCAATATA TGTCGGTATG CAAGAAATTC
ATTGCATCGA CGCAACATTT CAGTACTTGT TCCGTCTGTG GTTAACTGTT CAGCTGTTCT TTAGCTTTGT TTTGTACTTA
AGAGAGTACA AATTGTGAAC TGGTGATACA CTGATACTAA AACTCCTAAA AGTCCCGGTT TTGCTTGCTT ATGTCATGGC
TAGTCCAAAT TCAGCCATCA TAATAACCTT TTGCACAAAG CAAGGGCATA ACTCCACAAG AGTCAGTGTG CCTGACGAGC
CGATTAATTA TACCTGGTAC AATTTATATT CAAGTATTGT TCGATAGGAA ATATGTACTT ATTAGGCACT GCAAATTGGT
AGGAGAATTA TTGAAAGCTG TAAGATATTG TCTTCTACAC CAACTTGGCT CCGAGAAACA TAAGAAAAGC CGGCGCTGCA
TAAGTCAATT TCCCCAAGTA CTAGTCCATG CATCTGGCTT AGTTTAATCT GCTAGCCGAC ACCTTGTTCT TATTGTTTTT
CTCGAAAAAA GAATTGCTAG CTCTTCTGGA ATCGGTGCCC TATTTTCCAT TTTTACTGAT TTCATGTTGC GAATTGTGAT
GATTCCTTGG TCCTTTGGTC ACCGCTAACC TGCAAGCAGA AACAATCAAA CAACGCTCAC CGAATACGAC TCTCGGCGAT
TGGTGGCCTC TAGTGCACAA TCTTGCTTTG TTTCTGACGA AGATGTGTTT GTTTCCATCG TCTTCCACTA GGAACAAAAA
ACCATACATG TCGTTTTCTT TCCGGTGTCA CTTGAATGGT CTTTTCTGCA TCTTCCGTTT GGCATCTTGC CTTTAGAGAG
AGTGCATAAG TGTATCTTGC TAAGTACAAG TCGCAGTGGA GGCCTGACAT TTGGCAGATT CAGAGAAATG CATGGCCTGA
AACCTATGTT GTTAGAACAG GGAAAAGTTG TGGTGAGGTG AGATCAGTAG ATGTTACTAT CGTTGCTTTC AGCTGAGTTG
GTGGTAAGGA ATTGGGGAAA ATGCATTTTG CCAAATAAGT CAGATGTGTA CTTTGATTTG ATTCTCTGAG GGAAAATTAG
TAATCGCACT GCATTAGTAG TCATGCAGCA ATTTCAGTAT ATTGGTTACA GGTAGAAAAT AATTAGCATC ATAGTACCCT
CATTGATAAG GTTGTGAACG TTCAAAATGG TGCATCATAA AAACTTATGC TACTCGACAT GTTGATCAAG ATTTGGAGTG
TTGTATAGCA TATTGTACTG ACCTGAACAT TCACAAAATT GCTTAGGTTG AAGGTGCATT TGCAGAGGAT GGAAGAAAGC
CTAGTATCTG GGACACGTTT TCGCACTCAG GTTAGTTTGG TCTAAGATTT ACTTGTGAAA ATTGAGTCTG TGTCTACGAT
AAATTTCAAA TTCTTAAAAT TAACGAGAAC TTTCTAATTC TATTTTCCAC AGGCTATTCT GTTGATGGAG CAACCGGTGA
TGTAACTGCA GATCAGTATC ATAAGTACAA GGCAAGTTCT TGGGACAGTT CTGGTTAAGG TTTTTTTTTT CAGATTACGA
GCATGTCAAT TTCTGAAGAT GTAAAGCTTT TGCAATAACA AATATGTCTT TGATAACAGG AAGATGTAAA GCTTTTGCAA
GACATGGGCG TTGACGCGTA CAGGATGTCC ATTTCTTGGT CTCGGCTTAT TCCTGGTGAG TTTACGCTAA TAGTATTACT
GCATGTTCAG AAGTGTGCAT AAGAAAAATC AGCTGAAAGT TGACTGATTT GGTTGCTTGT ACATGTAGAT GGGCGAGGAG
CTGTCAATCC GAAGGGACTG GAATACTATA ACAACCTGAT TGATGAACTT CTGAGCCATG GTATGTAAAT GTAATCCCTT
TATCTGAACT GTTACTAATT TTGCAATGCT GAAATATGAG GATAATATTT TATCCATGTT TTTTGTGTTT ATGTAGGAAT
CCAACCTCAC GTAACGATAT ATCATTTCGA TTTTCCTCAG GCTCTCCAAG ATGAATACAA TGGGATACTT AGTCCTAGAT
TTGTGTACTT TCTTGCTACC CCCCTAAGCC TTACCCCCTT ACTGCAATTG CTTCCATATG AACTGAAATA ATATTGCTTT
TGCATTCTTG GCCATGATGT AGAGAGGACT TCACAGCATA CGCGGATGTC TGCTTCAAGA ACTTTGGTGA TAGAGTGAAG
CACTGGAGCA CTGTCAATGA GCCTAACATC GAGCCGATTG GCGGATACGA TCAAGGAATC CTTCCGCCAC GGCGATGCTC
ATTCCCCTTT GGTGTCCTCA GTTGTGACAA TGGCAACTCT ACCACAGAGC CATACATAGT AGCACATCAT CTTCTTCTTG
CACATTCCTC AGCAGTGTCC CTCTACAGAG AGAAGTACCA GGTCTGAAAT TAATGCCATC TTCTCTTACA GAAGGACCGA
TGATCATCTT CAGATATAGA ATCTAACCTT TGTCTATTGC TTATCAGGCC ACTCAAGGAG GACAAATTGG GCTCACATTG
CTCGGTTGGT GGTACGAGCC CGGGACGCAA GATCCTGAAG ATGTAGCAGC AGCTGCAAGG ATGAATGATT TCCACATTGG
ATGGTTTGTT ATGCTCCAAG TCTAGACTTC AAGTTTCACA AAAACACCTG AAGTTTTTCA TGTACCTTAC ATGTAAGATC
ATGTGTTTTT GGCTCAGGTA CATGCATCCT TTGGTGTACG GTGACTACCC TCCGGTAATG AGGAAGAATG TTGGGTCCAG
GCTACCATCT TTCACAGCTG AAGAATCAAA GAGAGTACTT GAATCCTATG ATTTTGTCGG ATTTAACCAC TATGTCGCCA
TTTTTGTGAG AGCCGACCTT AGCAAACTTG ATCAGAGCCT CAGAGATTAC ATGGGCGATG CAGCTGTCAA ATATGACCGT
AAGTGTCCTA ATGACATCAA ATCTTAGTAC GTCTCACAAT ATAACAACAG ATAATTTAAT TTTTCTACAC TTCTTTTGTT
CTTTTGCAGT CCCATTCCTG AAATCAAATA ATGAGGTATT CGGTGACATA ACTTGCTCTT GTGAAATTAT ACTGTCTGTC
TCTGAATTTA GTGCCAGACT GCCAGTACCT CCATCATGGC TAAAGCATTT CTCCTTTTTT TTTCTGATGG TGAAAAAACT
GAACAATAAC AGTTCCCACT CGGGTTGACG AGTGACTTCA TGACGTCGAC CCCATGGGCT CTGAAGAAGA TGCTCAATCA
TCTCCAAGAG AAGTACAAGA ACCCTATTGT CATGATCCAT GAGAATGGTA ACATCACCTG AAACACTGCC AACAACAGAG
CATCAACTGA TCAAACAGTT TTACACTTTT ACTGCAACAA TCACACTGCC AAGATGATTG AATCATCAGC TGATAAACAG
TCTTACTGCA ACAATCACAC TACCAAAATG ATTGAATCGT CAACTGATCA ACCGTTTTAC TGCAACAGTC ACACTGCCAA
CAATAAATCA TCAATTGATC AACAGTTTTA CTGCATCAGT TCAGATATAA TATATACTCA CTCTCTGCTA CATTGGCCAT
GCTTTTTCAG GAGCCGCTGG GCAGCCTGAC CCTTCAGGCG GAAACACCTA CGACGACGAT TTCAGGTCGC AATATCTGCA
GGATTACATC GAGGCCACAC TTCAATCCAT CAGGTATATG CTTTTTTCTT TTACATAATA TAAGCTTTAT TAAACCCATC
CAATTACACT AAGTGATACA ACCGTACCGA GAAAATTTCT CGGTCGGATT CATTTTTTTA TTAAAAAATT CGTGTTGAAA
TTTGAAATTT TGTTTGAACC GAGCAATAAA ACCCTCAAAG AAATTTCTCT ATTGGATTCA ATTTCTTTTT TATTTTTTTT
CAAAAAATCG TGTTGAAATT TGAAATATTT GTTTGAACCG AGTGCAGGAA CGGGTCGAAC GTGCAGGGCT ACTTCGTGTG
GTCGTTCCTG GACGTGTTCG AGTACCTGTT CGGCTACCGC CTCCGCTTCG GCCTCTACGG CGTCGACTTC GCCTCGCCGG
AGAGGACCAG GTACCAGAGG CACTCGGCGC GGTGGTACGC CGGCTTCCTC CGCGGCGGCG AGCTCCGGCC GGCGGCGGCG
GCGCTGGCCG GCGGCGGAGC CTACTCCCAG TGATCAAGGT TCTTCTTCCT CGCACGCTTT CATCTCGCGA AGAACAGGAC
AGGACGGGAC AATAAAATTT ACCTGGATAG ATACAGAAGA ATTATACAGT TCATATGGAA GTTGATCTTT TGAATAGGGT
CTTAGAATGA ATGGTCTCTC TTCTTCCCCT GGTTTTTGGT TCTTCTGTTT ACAGACCAAT GATGGGTCAA TGTCAGTCAA
ATTGTGTGAT TTAGATCAAT GGGTCAAAGT GTATGATGTG ATTGTGTAAT TGTGTCGATT ATATATAAAA TTTTGAAGTC
TCTCGTAGTT TG

Locus: Os09g0511600

Loading...

Locus: Os09g0511600

Loading...