Os09t0511600-04

Locus

Os09g0511600

Description

Glycoside hydrolase, family 1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BGLU31

CGSNL Gene Name

BETA-GLUCOSIDASE 31

Oryzabase Gene Symbol Synonym(s)

Os9bglu31, Os9BGlu31

Oryzabase Gene Name Synonym(s)

beta-glucosidase 31

Transcript Evidence

AK102869 (DDBJ, Best hit)

Protein Evidence

B7F7K7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 1 (IPR001360)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Glycoside hydrolase, superfamily (IPR017853)

Glycoside hydrolase, family 1, active site (IPR018120)

Full-length cDNA

J033111O12 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0511600-04)

Others

Oryzabase (12104)

Transcript

1992 bp

>Os09t0511600-04 Glycoside hydrolase, family 1 protein.
GGCCACCGAGGACGAGCTAGAGCGCGCGCGCCGCCGCGAAACATTAGCTATAGCTAGCTA
GATATAGCCGGCCGGCGATCGAGGAGATCGATCGATCGAACGCCGCCGCGCGCGCGCGGT
CATGACGCCGGCGAGGGTGGTGTTCATCTGCTGCGTTGTTCTGCTCGCCGCCGCCGCCGC
GGCGGCGTCGTCGTCGACGGCGGCGGGGATCACCAGGGCCGACTTCCCGCCGGAGTTCAT
CTTCGGCGCCGGCTCCTCCGCTTATCAGGTTGAAGGTGCATTTGCAGAGGATGGAAGAAA
GCCTAGTATCTGGGACACGTTTTCGCACTCAGGCTATTCTGTTGATGGAGCAACCGGTGA
TGTAACTGCAGATCAGTATCATAAGTACAAGGCAAATGTAAAGCTTTTGCAAGACATGGG
CGTTGACGCGTACAGGATGTCCATTTCTTGGTCTCGGCTTATTCCTGATGGGCGAGGAGC
TGTCAATCCGAAGGGACTGGAATACTATAACAACCTGATTGATGAACTTCTGAGCCATGG
AATCCAACCTCACGTAACGATATATCATTTCGATTTTCCTCAGGCTCTCCAAGATGAATA
CAATGGGATACTTAGTCCTAGATTTGTAGAGGACTTCACAGCATACGCGGATGTCTGCTT
CAAGAACTTTGGTGATAGAGTGAAGCACTGGAGCACTGTCAATGAGCCTAACATCGAGCC
GATTGGCGGATACGATCAAGGAATCCTTCCGCCACGGCGATGCTCATTCCCCTTTGGTGT
CCTCAGTTGTGACAATGGCAACTCTACCACAGAGCCATACATAGTAGCACATCATCTTCT
TCTTGCACATTCCTCAGCAGTGTCCCTCTACAGAGAGAAGTACCAGGCCACTCAAGGAGG
ACAAATTGGGCTCACATTGCTCGGTTGGTGGTACGAGCCCGGGACGCAAGATCCTGAAGA
TGTAGCAGCAGCTGCAAGGATGAATGATTTCCACATTGGATGGTACATGCATCCTTTGGT
GTACGGTGACTACCCTCCGGTAATGAGGAAGAATGTTGGGTCCAGGCTACCATCTTTCAC
AGCTGAAGAATCAAAGAGAGTACTTGAATCCTATGATTTTGTCGGATTTAACCACTATGT
CGCCATTTTTGTGAGAGCCGACCTTAGCAAACTTGATCAGAGCCTCAGAGATTACATGGG
CGATGCAGCTGTCAAATATGACCTCCCATTCCTGAAATCAAATAATGAGTTCCCACTCGG
GTTGACGAGTGACTTCATGACGTCGACCCCATGGGCTCTGAAGAAGATGCTCAATCATCT
CCAAGAGAAGTACAAGAACCCTATTGTCATGATCCATGAGAATGGAGCCGCTGGGCAGCC
TGACCCTTCAGGCGGAAACACCTACGACGACGATTTCAGGTCGCAATATCTGCAGGATTA
CATCGAGGCCACACTTCAATCCATCAGGAACGGGTCGAACGTGCAGGGCTACTTCGTGTG
GTCGTTCCTGGACGTGTTCGAGTACCTGTTCGGCTACCGCCTCCGCTTCGGCCTCTACGG
CGTCGACTTCGCCTCGCCGGAGAGGACCAGGTACCAGAGGCACTCGGCGCGGTGGTACGC
CGGCTTCCTCCGCGGCGGCGAGCTCCGGCCGGCGGCGGCGGCGCTGGCCGGCGGCGGAGC
CTACTCCCAGTGATCAAGGTTCTTCTTCCTCGCACGCTTTCATCTCGCGAAGAACAGGAC
AGGACGGGACAATAAAATTTACCTGGATAGATACAGAAGAATTATACAGTTCATATGGAA
GTTGATCTTTTGAATAGGGTCTTAGAATGAATGGTCTCTCTTCTTCCCCTGGTTTTTGGT
TCTTCTGTTTACAGACCAATGATGGGTCAATGTCAGTCAAATTGTGTGATTTAGATCAAT
GGGTCAAAGTGTATGATGTGATTGTGTAATTGTGTCGATTATATATAAAATTTTGAAGTC
TCTCGTAGTTTG

CDS

1572 bp

>Os09t0511600-04 Glycoside hydrolase, family 1 protein.
ATGACGCCGGCGAGGGTGGTGTTCATCTGCTGCGTTGTTCTGCTCGCCGCCGCCGCCGCG
GCGGCGTCGTCGTCGACGGCGGCGGGGATCACCAGGGCCGACTTCCCGCCGGAGTTCATC
TTCGGCGCCGGCTCCTCCGCTTATCAGGTTGAAGGTGCATTTGCAGAGGATGGAAGAAAG
CCTAGTATCTGGGACACGTTTTCGCACTCAGGCTATTCTGTTGATGGAGCAACCGGTGAT
GTAACTGCAGATCAGTATCATAAGTACAAGGCAAATGTAAAGCTTTTGCAAGACATGGGC
GTTGACGCGTACAGGATGTCCATTTCTTGGTCTCGGCTTATTCCTGATGGGCGAGGAGCT
GTCAATCCGAAGGGACTGGAATACTATAACAACCTGATTGATGAACTTCTGAGCCATGGA
ATCCAACCTCACGTAACGATATATCATTTCGATTTTCCTCAGGCTCTCCAAGATGAATAC
AATGGGATACTTAGTCCTAGATTTGTAGAGGACTTCACAGCATACGCGGATGTCTGCTTC
AAGAACTTTGGTGATAGAGTGAAGCACTGGAGCACTGTCAATGAGCCTAACATCGAGCCG
ATTGGCGGATACGATCAAGGAATCCTTCCGCCACGGCGATGCTCATTCCCCTTTGGTGTC
CTCAGTTGTGACAATGGCAACTCTACCACAGAGCCATACATAGTAGCACATCATCTTCTT
CTTGCACATTCCTCAGCAGTGTCCCTCTACAGAGAGAAGTACCAGGCCACTCAAGGAGGA
CAAATTGGGCTCACATTGCTCGGTTGGTGGTACGAGCCCGGGACGCAAGATCCTGAAGAT
GTAGCAGCAGCTGCAAGGATGAATGATTTCCACATTGGATGGTACATGCATCCTTTGGTG
TACGGTGACTACCCTCCGGTAATGAGGAAGAATGTTGGGTCCAGGCTACCATCTTTCACA
GCTGAAGAATCAAAGAGAGTACTTGAATCCTATGATTTTGTCGGATTTAACCACTATGTC
GCCATTTTTGTGAGAGCCGACCTTAGCAAACTTGATCAGAGCCTCAGAGATTACATGGGC
GATGCAGCTGTCAAATATGACCTCCCATTCCTGAAATCAAATAATGAGTTCCCACTCGGG
TTGACGAGTGACTTCATGACGTCGACCCCATGGGCTCTGAAGAAGATGCTCAATCATCTC
CAAGAGAAGTACAAGAACCCTATTGTCATGATCCATGAGAATGGAGCCGCTGGGCAGCCT
GACCCTTCAGGCGGAAACACCTACGACGACGATTTCAGGTCGCAATATCTGCAGGATTAC
ATCGAGGCCACACTTCAATCCATCAGGAACGGGTCGAACGTGCAGGGCTACTTCGTGTGG
TCGTTCCTGGACGTGTTCGAGTACCTGTTCGGCTACCGCCTCCGCTTCGGCCTCTACGGC
GTCGACTTCGCCTCGCCGGAGAGGACCAGGTACCAGAGGCACTCGGCGCGGTGGTACGCC
GGCTTCCTCCGCGGCGGCGAGCTCCGGCCGGCGGCGGCGGCGCTGGCCGGCGGCGGAGCC
TACTCCCAGTGA

Protein

524 aa

>Os09t0511600-04 Glycoside hydrolase, family 1 protein.
MTPARVVFICCVVLLAAAAAAASSSTAAGITRADFPPEFIFGAGSSAYQVEGAFAEDGRK
PSIWDTFSHSGYSVDGATGDVTADQYHKYKANVKLLQDMGVDAYRMSISWSRLIPDGRGA
VNPKGLEYYNNLIDELLSHGIQPHVTIYHFDFPQALQDEYNGILSPRFVEDFTAYADVCF
KNFGDRVKHWSTVNEPNIEPIGGYDQGILPPRRCSFPFGVLSCDNGNSTTEPYIVAHHLL
LAHSSAVSLYREKYQATQGGQIGLTLLGWWYEPGTQDPEDVAAAARMNDFHIGWYMHPLV
YGDYPPVMRKNVGSRLPSFTAEESKRVLESYDFVGFNHYVAIFVRADLSKLDQSLRDYMG
DAAVKYDLPFLKSNNEFPLGLTSDFMTSTPWALKKMLNHLQEKYKNPIVMIHENGAAGQP
DPSGGNTYDDDFRSQYLQDYIEATLQSIRNGSNVQGYFVWSFLDVFEYLFGYRLRFGLYG
VDFASPERTRYQRHSARWYAGFLRGGELRPAAAALAGGGAYSQ*

5'UTR

chr09:19887895..19888015 (- strand) : 121 bp

CDS

chr09:19887748..19887894 (- strand) : 147 bp

chr09:19885812..19885875 (- strand) : 64 bp

chr09:19885647..19885709 (- strand) : 63 bp

chr09:19885467..19885538 (- strand) : 72 bp

chr09:19885302..19885373 (- strand) : 72 bp

chr09:19885118..19885205 (- strand) : 88 bp

chr09:19884761..19885019 (- strand) : 259 bp

chr09:19884559..19884674 (- strand) : 116 bp

chr09:19884244..19884464 (- strand) : 221 bp

chr09:19884127..19884152 (- strand) : 26 bp

chr09:19883875..19883989 (- strand) : 115 bp

chr09:19883489..19883591 (- strand) : 103 bp

chr09:19883009..19883234 (- strand) : 226 bp

3'UTR

chr09:19882710..19883008 (- strand) : 299 bp

FASTA

>Os09t0511600-04 class=Sequence position=chr09:19882710..19888015 (- strand)
GGCCACCGAG GACGAGCTAG AGCGCGCGCG CCGCCGCGAA ACATTAGCTA TAGCTAGCTA GATATAGCCG GCCGGCGATC
GAGGAGATCG ATCGATCGAA CGCCGCCGCG CGCGCGCGGT CATGACGCCG GCGAGGGTGG TGTTCATCTG CTGCGTTGTT
CTGCTCGCCG CCGCCGCCGC GGCGGCGTCG TCGTCGACGG CGGCGGGGAT CACCAGGGCC GACTTCCCGC CGGAGTTCAT
CTTCGGCGCC GGCTCCTCCG CTTATCAGGT AGACACGTTT TTTTTCCCTT TTTTAGCGCG AACTCAACCA CCAAGCAAAC
CTGATCACTG CCGATGCATG CACAGTGCAC ACACATCTAT CTCTTGCTCT ACAAATCATG CAAAAAAGAA GGAAAAAACA
AAACTGTAAC TAGATACAAA TCGGATGGAG TTGAATCTGT TGCACAAATT AATTCGAAAC ATTAATTATA TTTCTCGCAT
CATCGATTTG CTCGTTAGAA TATCAGAGAG TACAAAATTT TACTGTCAAC GCCTGTCCAA GACTGCAACC TGTTCGTCGG
TATGTCCAAC CGCCACACTA TCTCGTTCGC TATTCCTGTC CATGTGTTCC CCCTGACTAA CACGAACCAT ACAAAATAAC
AATATAAAAT TCGTCGATTC AACGAGCACA TTCGTTGTGC CCTTTGTTCA ATTCTTGGAT AAAAACAGAC GGATGAAATT
CAGAGTGACT TTTTTGTTAA CCTCTCGCTT TCCTACTGAA CTTTAATCAC AGAAGTAGGC TTTGCTTCTT TCTTCGTTTA
ACCTTTGTGC TAACCAGTGT CACTCTCTTT ATGACTTGTT GTTTCACGTT AGTACTCTGG TAATATGCAA TATATGTCGG
TATGCAAGAA ATTCATTGCA TCGACGCAAC ATTTCAGTAC TTGTTCCGTC TGTGGTTAAC TGTTCAGCTG TTCTTTAGCT
TTGTTTTGTA CTTAAGAGAG TACAAATTGT GAACTGGTGA TACACTGATA CTAAAACTCC TAAAAGTCCC GGTTTTGCTT
GCTTATGTCA TGGCTAGTCC AAATTCAGCC ATCATAATAA CCTTTTGCAC AAAGCAAGGG CATAACTCCA CAAGAGTCAG
TGTGCCTGAC GAGCCGATTA ATTATACCTG GTACAATTTA TATTCAAGTA TTGTTCGATA GGAAATATGT ACTTATTAGG
CACTGCAAAT TGGTAGGAGA ATTATTGAAA GCTGTAAGAT ATTGTCTTCT ACACCAACTT GGCTCCGAGA AACATAAGAA
AAGCCGGCGC TGCATAAGTC AATTTCCCCA AGTACTAGTC CATGCATCTG GCTTAGTTTA ATCTGCTAGC CGACACCTTG
TTCTTATTGT TTTTCTCGAA AAAAGAATTG CTAGCTCTTC TGGAATCGGT GCCCTATTTT CCATTTTTAC TGATTTCATG
TTGCGAATTG TGATGATTCC TTGGTCCTTT GGTCACCGCT AACCTGCAAG CAGAAACAAT CAAACAACGC TCACCGAATA
CGACTCTCGG CGATTGGTGG CCTCTAGTGC ACAATCTTGC TTTGTTTCTG ACGAAGATGT GTTTGTTTCC ATCGTCTTCC
ACTAGGAACA AAAAACCATA CATGTCGTTT TCTTTCCGGT GTCACTTGAA TGGTCTTTTC TGCATCTTCC GTTTGGCATC
TTGCCTTTAG AGAGAGTGCA TAAGTGTATC TTGCTAAGTA CAAGTCGCAG TGGAGGCCTG ACATTTGGCA GATTCAGAGA
AATGCATGGC CTGAAACCTA TGTTGTTAGA ACAGGGAAAA GTTGTGGTGA GGTGAGATCA GTAGATGTTA CTATCGTTGC
TTTCAGCTGA GTTGGTGGTA AGGAATTGGG GAAAATGCAT TTTGCCAAAT AAGTCAGATG TGTACTTTGA TTTGATTCTC
TGAGGGAAAA TTAGTAATCG CACTGCATTA GTAGTCATGC AGCAATTTCA GTATATTGGT TACAGGTAGA AAATAATTAG
CATCATAGTA CCCTCATTGA TAAGGTTGTG AACGTTCAAA ATGGTGCATC ATAAAAACTT ATGCTACTCG ACATGTTGAT
CAAGATTTGG AGTGTTGTAT AGCATATTGT ACTGACCTGA ACATTCACAA AATTGCTTAG GTTGAAGGTG CATTTGCAGA
GGATGGAAGA AAGCCTAGTA TCTGGGACAC GTTTTCGCAC TCAGGTTAGT TTGGTCTAAG ATTTACTTGT GAAAATTGAG
TCTGTGTCTA CGATAAATTT CAAATTCTTA AAATTAACGA GAACTTTCTA ATTCTATTTT CCACAGGCTA TTCTGTTGAT
GGAGCAACCG GTGATGTAAC TGCAGATCAG TATCATAAGT ACAAGGCAAG TTCTTGGGAC AGTTCTGGTT AAGGTTTTTT
TTTTCAGATT ACGAGCATGT CAATTTCTGA AGATGTAAAG CTTTTGCAAT AACAAATATG TCTTTGATAA CAGGAAGATG
TAAAGCTTTT GCAAGACATG GGCGTTGACG CGTACAGGAT GTCCATTTCT TGGTCTCGGC TTATTCCTGG TGAGTTTACG
CTAATAGTAT TACTGCATGT TCAGAAGTGT GCATAAGAAA AATCAGCTGA AAGTTGACTG ATTTGGTTGC TTGTACATGT
AGATGGGCGA GGAGCTGTCA ATCCGAAGGG ACTGGAATAC TATAACAACC TGATTGATGA ACTTCTGAGC CATGGTATGT
AAATGTAATC CCTTTATCTG AACTGTTACT AATTTTGCAA TGCTGAAATA TGAGGATAAT ATTTTATCCA TGTTTTTTGT
GTTTATGTAG GAATCCAACC TCACGTAACG ATATATCATT TCGATTTTCC TCAGGCTCTC CAAGATGAAT ACAATGGGAT
ACTTAGTCCT AGATTTGTGT ACTTTCTTGC TACCCCCCTA AGCCTTACCC CCTTACTGCA ATTGCTTCCA TATGAACTGA
AATAATATTG CTTTTGCATT CTTGGCCATG ATGTAGAGAG GACTTCACAG CATACGCGGA TGTCTGCTTC AAGAACTTTG
GTGATAGAGT GAAGCACTGG AGCACTGTCA ATGAGCCTAA CATCGAGCCG ATTGGCGGAT ACGATCAAGG AATCCTTCCG
CCACGGCGAT GCTCATTCCC CTTTGGTGTC CTCAGTTGTG ACAATGGCAA CTCTACCACA GAGCCATACA TAGTAGCACA
TCATCTTCTT CTTGCACATT CCTCAGCAGT GTCCCTCTAC AGAGAGAAGT ACCAGGTCTG AAATTAATGC CATCTTCTCT
TACAGAAGGA CCGATGATCA TCTTCAGATA TAGAATCTAA CCTTTGTCTA TTGCTTATCA GGCCACTCAA GGAGGACAAA
TTGGGCTCAC ATTGCTCGGT TGGTGGTACG AGCCCGGGAC GCAAGATCCT GAAGATGTAG CAGCAGCTGC AAGGATGAAT
GATTTCCACA TTGGATGGTT TGTTATGCTC CAAGTCTAGA CTTCAAGTTT CACAAAAACA CCTGAAGTTT TTCATGTACC
TTACATGTAA GATCATGTGT TTTTGGCTCA GGTACATGCA TCCTTTGGTG TACGGTGACT ACCCTCCGGT AATGAGGAAG
AATGTTGGGT CCAGGCTACC ATCTTTCACA GCTGAAGAAT CAAAGAGAGT ACTTGAATCC TATGATTTTG TCGGATTTAA
CCACTATGTC GCCATTTTTG TGAGAGCCGA CCTTAGCAAA CTTGATCAGA GCCTCAGAGA TTACATGGGC GATGCAGCTG
TCAAATATGA CCGTAAGTGT CCTAATGACA TCAAATCTTA GTACGTCTCA CAATATAACA ACAGATAATT TAATTTTTCT
ACACTTCTTT TGTTCTTTTG CAGTCCCATT CCTGAAATCA AATAATGAGG TATTCGGTGA CATAACTTGC TCTTGTGAAA
TTATACTGTC TGTCTCTGAA TTTAGTGCCA GACTGCCAGT ACCTCCATCA TGGCTAAAGC ATTTCTCCTT TTTTTTTCTG
ATGGTGAAAA AACTGAACAA TAACAGTTCC CACTCGGGTT GACGAGTGAC TTCATGACGT CGACCCCATG GGCTCTGAAG
AAGATGCTCA ATCATCTCCA AGAGAAGTAC AAGAACCCTA TTGTCATGAT CCATGAGAAT GGTAACATCA CCTGAAACAC
TGCCAACAAC AGAGCATCAA CTGATCAAAC AGTTTTACAC TTTTACTGCA ACAATCACAC TGCCAAGATG ATTGAATCAT
CAGCTGATAA ACAGTCTTAC TGCAACAATC ACACTACCAA AATGATTGAA TCGTCAACTG ATCAACCGTT TTACTGCAAC
AGTCACACTG CCAACAATAA ATCATCAATT GATCAACAGT TTTACTGCAT CAGTTCAGAT ATAATATATA CTCACTCTCT
GCTACATTGG CCATGCTTTT TCAGGAGCCG CTGGGCAGCC TGACCCTTCA GGCGGAAACA CCTACGACGA CGATTTCAGG
TCGCAATATC TGCAGGATTA CATCGAGGCC ACACTTCAAT CCATCAGGTA TATGCTTTTT TCTTTTACAT AATATAAGCT
TTATTAAACC CATCCAATTA CACTAAGTGA TACAACCGTA CCGAGAAAAT TTCTCGGTCG GATTCATTTT TTTATTAAAA
AATTCGTGTT GAAATTTGAA ATTTTGTTTG AACCGAGCAA TAAAACCCTC AAAGAAATTT CTCTATTGGA TTCAATTTCT
TTTTTATTTT TTTTCAAAAA ATCGTGTTGA AATTTGAAAT ATTTGTTTGA ACCGAGTGCA GGAACGGGTC GAACGTGCAG
GGCTACTTCG TGTGGTCGTT CCTGGACGTG TTCGAGTACC TGTTCGGCTA CCGCCTCCGC TTCGGCCTCT ACGGCGTCGA
CTTCGCCTCG CCGGAGAGGA CCAGGTACCA GAGGCACTCG GCGCGGTGGT ACGCCGGCTT CCTCCGCGGC GGCGAGCTCC
GGCCGGCGGC GGCGGCGCTG GCCGGCGGCG GAGCCTACTC CCAGTGATCA AGGTTCTTCT TCCTCGCACG CTTTCATCTC
GCGAAGAACA GGACAGGACG GGACAATAAA ATTTACCTGG ATAGATACAG AAGAATTATA CAGTTCATAT GGAAGTTGAT
CTTTTGAATA GGGTCTTAGA ATGAATGGTC TCTCTTCTTC CCCTGGTTTT TGGTTCTTCT GTTTACAGAC CAATGATGGG
TCAATGTCAG TCAAATTGTG TGATTTAGAT CAATGGGTCA AAGTGTATGA TGTGATTGTG TAATTGTGTC GATTATATAT
AAAATTTTGA AGTCTCTCGT AGTTTG

Locus: Os09g0511600

Loading...

Locus: Os09g0511600

Loading...