Os09t0513500-00

Locus

Os09g0513500

Description

Similar to ZCN24.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FTL4

CGSNL Gene Name

FLOWERING TIME LIKE GENE 4

Oryzabase Gene Symbol Synonym(s)

OsFT, osFT, FT-L 4, OsFTL4, FT-L4

Oryzabase Gene Name Synonym(s)

FT-like gene 4

Transcript Evidence

CT841571 (DDBJ, Best hit)

Protein Evidence

A9LLZ6 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Phosphatidylethanolamine-binding, conserved site (IPR001858)

Phosphatidylethanolamine-binding protein PEBP (IPR008914)

Expression Databases

TENOR (Os09t0513500-00)

Others

Oryzabase (11226)

KEGG (Os09t0513500-00)

Transcript

852 bp

>Os09t0513500-00 Similar to ZCN24.
ACAGAAAATTTGTTAGCTAGCCCTTCCACCTTATTGAATATTTCCCAATTCCCTTCTCAC
CAAGGATCAATAAAATTATGTCACGAGGTAGGGATCCTTTGGCATTGAGCCAGGTAATTG
GCGATGTGTTGGATCCTTTCATAAAGTCAGCTGCAATGAGGATTAATTATGGTGAGAAGG
AGATTACAAATGGAACTGGAGTACGATCATCTGCTGTTTTCACTGCACCACATGTTGAGA
TTGAAGGTCGTGACCAAACGAAGCTCTACACACTTGTTATGGTGGATCCTGATGCGCCAA
GTCCAAGCAAACCAGAATACAGGGAATATTTGCATTGGTTGGTGACAGACATCCCAGAGG
CAATAGATGCACGTTTTGGTTAAGCAGTTGGACGGTTGTTATCTGCCCAACAGCGCCTCA
AGAAGCACGACAAACAGTTTATGCTCCAGGATGGCGGCAAAATTTCAACGTCAGAGATTT
CTCTGCATTTTACAATCTTGGACCACCTGTTGCTGCATTATACTTCAACTGCCAGAAGGA
GAGTGGTGTTGGTGGCAGAAGGTTTCAGGGACCAAGTTGAAGGCTGGATGCAACATCATT
CAAGATTACAAAACATAATGCACAAAACGCAGTTAACAGCATATATATAGCAGTTGACAA
TCAAGTAGTCTAGTAATTGACTTGTATTGTATGAAATAAATTAGAAGTCCAATATCTTCA
TAGTCACCTATTAATGCTGATGTTCATATCAGTAATTATGAGGAATAGTGCAACAGTTGG
TGTTCTCTACTTTAAAATGAACACAAATTAGCACATACATATATGCAAATCTGAATTCTT
TTTACTCGCAGC

CDS

306 bp

>Os09t0513500-00 Similar to ZCN24.
ATGTCACGAGGTAGGGATCCTTTGGCATTGAGCCAGGTAATTGGCGATGTGTTGGATCCT
TTCATAAAGTCAGCTGCAATGAGGATTAATTATGGTGAGAAGGAGATTACAAATGGAACT
GGAGTACGATCATCTGCTGTTTTCACTGCACCACATGTTGAGATTGAAGGTCGTGACCAA
ACGAAGCTCTACACACTTGTTATGGTGGATCCTGATGCGCCAAGTCCAAGCAAACCAGAA
TACAGGGAATATTTGCATTGGTTGGTGACAGACATCCCAGAGGCAATAGATGCACGTTTT
GGTTAA

Protein

102 aa

>Os09t0513500-00 Similar to ZCN24.
MSRGRDPLALSQVIGDVLDPFIKSAAMRINYGEKEITNGTGVRSSAVFTAPHVEIEGRDQ
TKLYTLVMVDPDAPSPSKPEYREYLHWLVTDIPEAIDARFG*

5'UTR

chr09:19986302..19986378 (- strand) : 77 bp

CDS

chr09:19986104..19986301 (- strand) : 198 bp

chr09:19985021..19985082 (- strand) : 62 bp

chr09:19983477..19983517 (- strand) : 41 bp

chr09:19982455..19982459 (- strand) : 5 bp

3'UTR

chr09:19982417..19982454 (- strand) : 38 bp

chr09:19981183..19981322 (- strand) : 140 bp

chr09:19980206..19980496 (- strand) : 291 bp

FASTA

>Os09t0513500-00 class=Sequence position=chr09:19980206..19986378 (- strand)
ACAGAAAATT TGTTAGCTAG CCCTTCCACC TTATTGAATA TTTCCCAATT CCCTTCTCAC CAAGGATCAA TAAAATTATG
TCACGAGGTA GGGATCCTTT GGCATTGAGC CAGGTAATTG GCGATGTGTT GGATCCTTTC ATAAAGTCAG CTGCAATGAG
GATTAATTAT GGTGAGAAGG AGATTACAAA TGGAACTGGA GTACGATCAT CTGCTGTTTT CACTGCACCA CATGTTGAGA
TTGAAGGTCG TGACCAAACG AAGCTCTACA CACTTGTAAG TGTCATAATT TGTAGGATCA TGATCAGAGT AGTGTACAGG
TCTTTTGAAC CATTCTGTTA GGTAAGGTGA AAATGACTTT TGATCCAAAC AAAGCTTCAA GTTAAAAAGA TTTCTCTCGT
GTCAGAAGAG GTAATATTTA TTTTCTAGAA TATTAGATAA TTTCTTATGG AGTGACTCAT GCATATGCAC ACTAATTAAT
GAAACATGTT TGTTACTCCA GGCACCCTAC GTTTTAAAGA AATAATGCAC AGATCTAATT AGTGCTTCAC CAGAAAAGGC
CATCTAACTT GCACAAGTAT AGATTATTCA ACAGATCCAT AGGTACTGTC GATAATAGAA ATATGAGGGA TATAGCTTAT
TAGGTTTCAC AGAATATTGT AGTGGCAGGA AAACTAAATC ATAATGCCAG CTGGTATTTG CTAAAAAAGT AATCATATTG
TAACCTTTTG GTAATGATCA AGTACACATA TGGTACAATC TACTTTAGAA TATACTTGTG CACCCCTGTC TTGTTTGTAC
ACTGTGGTAC AGGAATATTG GATAGGATAA GGCCCTGTCA TGTCTGATTT ACTTAAAGTG AGAAATTGAA TCTCTGCTGT
ATTAAAGTTG GTAATTTGGC ATACTTTCTC ATATCAGCAT CCTTTCCACA ACAATAGACA CTGCCACACA TTTCAAATTA
TCCATGAAAT ATCACGCACT AAAATATCCA GCCTGAACTC ACTGTAGAAA AGTAAGACTG TAAGATACTA AGCTGATCCC
ACTTCCCTGC ACAGTGCTGC TCTAACCACT AATAGGCACT CTACAACTTT AATTTTATCA CAAAACCTCA CATAATTAGC
ATGGAGAGGG TGAAAACTTA TATGGTTTTT ATTTTTTATG GTCTCCAGAA TACCTTTTTG TCTCTCTTTT TTTCTGTTTG
CTTTATTGAG CTATGCCCTA GGTCCTCTAT AAGGCATGCA ACTAGTCCTT GATATCTATG TCTAAATGCT AAAATAAAAG
GTTTTCCTTT TATAAGGTTA TGGTGGATCC TGATGCGCCA AGTCCAAGCA AACCAGAATA CAGGGAATAT TTGCATTGGT
GAGCTTATTG AATTTATTAT ACAAGCAAAG AGTTGCATAA TGCCTTCCTA AAAACTCAAC AAAGCCACAT TTTGCAAGAA
ACCAATGAGT GCTACTTGCC ACACTATTGT TATGTTTATA GTTCAAGAAC ACCTTACCTA GATAACCTGC AGGATTGGAA
TGCAGCCCTC TCGAAAAGGA GGGGGGTGTT TCTTATCCAA CCATCAACAG CTGAAGAACT CTTGTTCTAT ATGCTATTGG
GTAAGAAAGT ACAATTTCTG TGATAACTTA ATTCTTTTCA TCACCATAAT TCCCTCAACC TAAGTCTCTT TGTTCAGATT
GTCATTTCTT ATCATCAATC ATTAGTTCTT AAATTGGCAC TATTATGTAG CTTCAAAATA AAATTGCCAA TACTTCAAAC
TATTTCATAT TATCTTAATA GTTTATACTT TCTAGTATTT AAGAAGGCAC CTTACCAACT TCTCATGGAG AAGGTACTCT
GGAAGTTTGC CTATTAATTT CTTCATAGAT AAAGTAAGGA GAAACCAGTC ATGATCCTGA GTAACTCTAA GGACATCATT
ATTGGGTGCT ACAATCAATT AACATATCAA CATAAGATGA TAAACTATGA AAAAACATTA ATTGACGGCA TTATTTATGA
TATCAGCATG AAGGACTTCA TGTAGATAGC ATGCATGCAT GCAATTATAC GGTTACAGGG AAAAAATGGC TAGAATTTAA
AGATACCTTA AAAAAGAAAC ATGTGCTGGA GCTAATGCTT ACAGGTAATG TCACATATGG CTAAAATAAG TAAATAACAT
TAATGCGTGT TAAATTGAAA TTTATGTTTT TCTTATTATG TTTATAAACA AGACTAATGG ATTTTGTATA ATTTGTAACT
GGGAATACTA GTATCATGGA TTTTGAATAC TAATATCATT ATAAATAAGA ATTGTAATAT CATTCTTATT ATGTTTATAA
ACAAGTGCTG GAGCTAATAT CAAAATTTGT AACTGGGAAG TTTATGATTT TGAATATAAT TAGAAGCTAA CTAATCTAGA
AGATGTATTA AGAGCCTTGC TATGGCATAT TAATATAGAA GAACTGTGCC CTTTACCACC AAACAAACTT ATGAGTAACT
AATCTTAATT AAACTTTCAA AGGATGATCT GATGTAACAT GATGGTCATT TGCAACACTG AATTTTTTTT TTCAGTTGAT
CGGGCAAATT CTTGCTTGCT GTGTACTACT AACAATGTGG TACCATAATA TATCTAAAAT ATTATATATT GATTATCTAA
TCTAATCCAT GTTTCTGCAA CTCATATCTC CTTACATAGA TTTGCGTTTT TCATAAGAGT AAAGATTTCC AATTTGACCA
TACATGAAGT TTCTTTAATT AACATATAAC TTATCATAGT ATCTTATTAT TTGTGTCCTT TACAAGCAGT TCTTACTTCT
GAGCCTAATC AAAGAGCTAA AGCTAGGGTC TTGTTTCTTT CTTCTTGTTA TTTTTCTACA GGTTGGTGAC AGACATCCCA
GAGGCAATAG ATGCACGTTT TGGTGGGTAA CATCTTACTC CTACATAACC TCCAATGTTG AGTAATTGCA TGTACAGATC
AGCAAACATT TTTATTATAC AAACAGCAAA ATCACTTCCA ATATTTGCCA TTTGTTTCAA ACAGAAATCA TGATATTTAT
TGTTGTATAT GGTTGTAAAC ATTTCACAAG TACCCTTGGC AATGGAATAA CCACGTGGTT AGTAAAATCT ATGTCAAGTT
GGAAAAATAA ATGATGATAG AGACAGGAGT AACTATGGAA ATACTACTAT AACTAATATA ACTGTTTGGA AATATCGTTG
GTTTGATCCA ACCAAAATAC CAAATACCTT AATACTTCCA TGAAATAATT GTTTTGCTAA AATTATGTTA GTGCATATAT
TTCCAAGATT TTAAGTAAAC AAGTTTACTG TATGAAACTT GATGAATTTT ATTTGTATAG TAGGCTGGTG TTTGGGGTGT
CAAGGTAGAA ATCTACGAGG GTGTTACATA TGCAAAAGTA AAAGACATGA TAAAAATGCT AAGGAATGAT TCAAAAGAAT
GCATTGGTCT TCATAGTTTA TGTTACTATC GACCATGATT ACACAGTCAA ATTTTGCAAA GAAAGTATAG GGAGCTTGAG
ACAATCAATT TATCTCCTGT ACTAAGCTAA CAAGACAAGG ATCAAGTCAA TAATTATTTT AGATGTCATA TACACTGAAA
ATCAATGGCA TTTTCATTAA AGGTGCATTT AGTAGGTCAT CTATCAGACT ATCACATACC GAGATTCCTT TTCTTTAATT
GGAAAATCTA GTTCTATATC CCTACACTTG TTGTTCTTTT GGATTTAAGG TGACATTGCA AAAATTAAGA AAAAAACATT
AGGTCCCTAA TTTTAAAGTA AGTCTGCGAT TGATCTATTG ACTACTAAAC TATATACAGT CATCTTAAAT ATGCATACCT
GTGAATCAAA TGTAAAGCAA CTTAGGGAGA GGGGGATGGG CCCCGCTCTA ATGTATGACT GCACCTATTT TTGATGCAGG
TTAAGCAGTT GGACGGTTGT TATCTGCCCA ACAGCGCCTC AAGTTGAGTA CCTCAGATCA TCTGTGGGGC CCACTGATGA
AATTAGTATA TGTGGCTATT ATGGTATTAC CTGCCTATGG TTGACCAATG GTTCTGTTGT GTGGGGCCCC ACAGAAACAC
ACACCTAATC TGTGTGACAT ACTTCAGATT TTTCAAACAT GAGATCTTTC ATTTCCAAGT GAAAACATAA TACTATCGTT
TCTGGAGTTT TAAGGAAAAC CAAGGTGTAA AGTTATCACA TGCCCTCTGT CCCTCCCTAA AGAAGCTGCC AACTAGGAAT
AATCATGTGA GCAACTGAAA ATAATAATAG TTCAAAAACA GCACTACTGT TTTCCCACAA AAAACACTAG TAGCATTACA
AATTACAGAC TTCTTTGGAG CCAAGCTGCA ATGCTGGAGT TATAACTTAT AAGCATACCT TCGGTAGTGC ATACATGAAG
CACGCCTGAT CCTCTCATCT GGCTCATCCC AAGGATATCA GAGAGGCACA CTCTTTTCTG CTAAATTATC AAGATTGCAA
GTGATTATTT AAACATCAAA TCTAGTTTTA TGAATATTGA AAAAAATAAA TGTAAGTCAC ATAATATACT AGAACTCAGG
CATTTACTAT TTTTTATTAG TCACACACTC ACACTTAATG GTCACATAAT AAAAATGGTT CACCTCTTTT TTTTATATAT
GCATTTTCAC TAGTGGGATT TCAACTTTAA TATTTATTTT CATGTGGAAG CCATGACAGA TATTCAGGAT GTGCAATTGG
TTGCAATACT TCTAACCATA ATGATATttc gtgaaacaac atgtaccaca gggtattgtt tatttgcttt aattggCAGC
AAGTGGCACA GGACTGAAGG GTGGGCAGTA ATGTCACTGA ATGACTGAAC TATAGGACAA TCTATACCAC ACTATCAAGG
AACATGTAGT CTGTAGAGTG ATGTGGTGAA AGCTAACATT CACCTTGATA ATATGAACCA CAACAAAACA AATCTAATAA
AGAATACACA CTGTTTCAGG CAATGAAATA GTTCCGTACG AAGCTCCACG GCCACCGGCT GGAATTCATC GGCTTGTTTT
TGTGCTATTC AAACAGGAAG CACGACAAAC AGTTTATGCT CCAGGATGGC GGCAAAATTT CAACGTCAGA GATTTCTCTG
CATTTTACAA TCTTGGACCA CCTGTTGCTG CATTATACTT CAACTGCCAG AAGGAGAGTG GTGTTGGTGG CAGAAGGTAG
GAACAAATTT AATATTTTAC TTAAAGAGAG ACTAAAACAA TAAATATTCA TATATTGGTA GTCATGAAAT CACAGGAGCC
AGATAGACTC ATACACCCCC TCTCAAAACA TAACCATGAC ATTTTTGATT GAAAATTCAT AGACTTAGAC GTGGCATCTA
CTCTAACACA AGCATAAGAT TTCCAAAGAT GCTCTAGAGA AAAGATTCTG AGGATCGCTA AAGCTCATTG CATATATCTG
GAAGATACAA AATAGGTTTA TTAGTAATAC ACGTTTCTTC CCAGAATAGT GAATTCAGAG TAGAATATCA ACTTAAGTTC
CTAGCTTAGT ACCTTTTTAG GACACGGGTG CGCTTACTTT ACCCTGTTCA TGATAATGAG CAAGCTTTCC ATGACATAAG
TGCACATATG TAGTTTTAAT TACCATGGCA ATTTTGTCAA CAGAAATAAG CCTTCTCGCA TCCTTTTTAA TGCTGAACAA
TTATTCTACT CACTATATAC ACTTCCGGTG TTTCAAAAGA AACAAACAAT ACATTAGATT ACAAAGATGG CATGTTTATC
CCCCCTATTC ATATATGCAA GAAGCCAAGA CCTAGACACC AAAACAATAA CAAACTAGGC ATGCTGTTTT TAGGAGAAAA
GCCATCATTT ACTAATTCTT TTTTTCTATT CTTTGTTAAT AGGTTTCAGG GACCAAGTTG AAGGCTGGAT GCAACATCAT
TCAAGATTAC AAAACATAAT GCACAAAACG CAGTTAACAG CATATATATA GCAGTTGACA ATCAAGTAGT CTAGTAATTG
ACTTGTATTG TATGAAATAA ATTAGAAGTC CAATATCTTC ATAGTCACCT ATTAATGCTG ATGTTCATAT CAGTAATTAT
GAGGAATAGT GCAACAGTTG GTGTTCTCTA CTTTAAAATG AACACAAATT AGCACATACA TATATGCAAA TCTGAATTCT
TTTTACTCGC AGC

Locus: Os09g0513500

Loading...

Locus: Os09g0513500

Loading...