Os09t0517600-01

Locus

Os09g0517600

Description

Class I formin protein, Regulation of grain size, Control of microtubule and actin filament cytoskeleton systems

RAP-DB Gene Symbol Synonym(s)

OsFH15

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFH15, FH15

Oryzabase Gene Name Synonym(s)

formin homology 15, forming family protein 15, FH2 protein 15, FH2 domain protein 15

Transcript Evidence

AK101828

Protein Evidence

Q69MT2

Literature

PMID: 28747699

Note

Manual Curation

April 3, 2018

Functional domain (InterPro)

Formin, FH2 domain superfamily (IPR042201)

Formin, FH2 domain (IPR015425)

Full-length cDNA

J033068F13 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0517600-01)

RiceXPro (AK101828)

Others

Oryzabase (21774)

KEGG (Os09t0517600-01)

Transcript

2861 bp

>Os09t0517600-01 Class I formin protein, Regulation of grain size, Control of microtubule and actin filament cytoskeleton systems
GCTCCCCTCGCCTACCCACAGCTGTTCACATCACTCCCGCTCCTCGAGAACACCACTCCC
TCCTACTAGTAGCTTCTCTCTCTCTCTCTTCTTCTTCCTCGCTTTGCTTGGGTTGGGTTG
GAGCGGTGAGACGAGAGATTGAGGGGAGGAGAGGAGAGGACAGCAGCTGCCCCTCGATTC
GATTCTTGAGTGATCATCTTGGGCTTGGGCGTTGGCGCCAATGCTCGCGCGGTGGCTGCT
CGTGCTGCTCCTCTTGCTGCCTGTTTCTTGGTGTCATCAAGATCGGCATGGCCGCCGCCA
TTACCCGCGGCGGTGGAGGAGCAGCGGCAGTAGGAGGGAGCTGCACGAGCCGCTGTTCCC
TCTCGAGAACGCGCCCGCGCTGCCACCGCCGCCGCCGCCGCCACCGGCGCCGTTCTTTCC
GTTCTTGCCTGACTCCGCCCCGCCGCAGCTGCCACCGCCGGTGACCACGCCCGCTCCCGC
CGGTGGCGCCGGAGATGGTGGTACGGACGCAGGCGCCGCCGCCACCGGGGACGCGTCTTC
GTCTTCGTCCTCGTCGGCGTCGCCGCACCCCACGGcgccggcgaacatctcgtacatggc
catgcccatctaccactccgcgccgctccgctccttcctgtcgtcgcaccgcctcctcac
cgtcctcctcccggtcgccgccgtcctcgccgccgtgctagccgcggcgctcgtctacct
cctcacgcgacgccgccgCTGCTCCAAGGGGGAGCCGCACGCGGCGCATACGAAGGCCGT
GCTGCTTTCCCCGGGGAACTCCACGGCGCTCTACGACGGCGACCACGACCAGCATGGCCG
GGGGTCCACCGCCACCGCAGCCTCCAGCGCCAGCTCGCCGGAACTCCGGCCGATGCCGCC
TCTACCCCGGCAGTTCCAGCAGACGAGGACGAGCATGCCGTCAACTTCGCAAACCATCCA
TGAAGCCGGAGCAGAGGACAAGCGAGCGCCGCCACCGCAGAGTGTTCGACCGCCGCCGCC
ACCACCACCACCTCCTCCTCCGCCGCCAATGCCGCCGAGAACGGACAACGCGAGCACGCA
AGCAGCGCCCGCGCCTCCCCCGCCATTGCCGCgagccggcaacggcagcggctggctgcc
acggcggtacacggagcgcgccgcgccgacggtgatcagggcctcggcgggggcagtcca
cccggaggagtcgccggcgcgcgCCTCGCCGGAGGAGAAGGCCGCCGACGCGGCCGCTCG
GCCGAAGCTGAAGCCGCTGCACTGGGACAAGGTGCGGCCGGCGAGCTCCGGCCGGCCGAC
GGTGTGGGACCAGCTGAAGGCGAGCTCATTCCGAGTGAACGAAGAGATGATCGAGACGCT
CTTCGTCTCCAACTCGACGAGGAGAGCATCCAAGAATGGAGTCAAGGAGGCAAATGCAGC
TTGCTGCAACCAGGAGAACAAGGTGCTGGACCCGAAGAAATCGCAGAACATCGCGATCAT
GCTGAGGGCGCTCGACGCGACGAAGGAGGAAGTCTGCAAGGCTCTCCTGGATGGCCAGGC
AGAGAGCCTTGGAACTGAGCTGCTGGAGACACTTCTAAAGATGGCTCCTAGCAGAGAAGA
GGAAATCAAGCTGAAGGAATTCAGGGAGGATGCCGTATCTAAGCTCGGCCCTGCCGAAAG
CTTCCTCAAGGCGGTGCTTGCGATACCATTTGCGTTCAAGAGGGTCGAAGCAATGCTCTA
CATCGCCAACTTCGATTCGGAGGTTGACTACCTCAAGACCTCCTTCAAAACTCTTGAGGC
AGCATGTGAAGAGCTGAGGGGCAGCAGGTTGTTCCACAAGATCTTAGATGCAGTGCTGAA
GACCGGTAACCGCATGAACACtggcaccaaccgcggaaatgcaagcgccttcaagcttga
tgccctcctcaagttagtcgacgtaaagggtgcagatggcaagacaacccttctgcattt
tgttatcgaagagattgtcaagtccgaaggtGCCAGCATCTTGGCCACTGGCCAAACATC
CAACCAGGGGAGTGCCATTGCAGATGATTTCCAGTGCAAGAAGGTTGGCCTCAGAATTGT
TGCTAGCCTTGGTGGTGAGCTCGGCAATGTCAAGAAGGCAGCTGGAATGGACTCAGACAC
ACTGGCCAGCTGCGTTGCCAAGCTTTCTGCTGGTGTTAGCAAGATCAGTGAGGCCCTGCA
GCTGAACCAGCAGCTCGGTTCCGATGATCATTGCAAGAGATTCCGCGCCTCAATCGGTGA
GTTCCTGCAGAAGGCCGAAGCTGAGATCACCGCAGTGCAGGCTCAGGAGAGCCTCGCCCT
CTCCCTCGTCAGGGAGACGACCGAGTTCTTCCACGGTGACTCGGTGAAGGAGGAAGGGCA
CCCTCTGAGAATCTTCATGGTGGTGCGCGACTTCCTCACCGTTCTTGATCATGTCTGCAA
GGATGTCGGCAGGATGAACGAAAGAACAGCGATTGGATCTTCGCTCCGGCTGGAGAATGC
ACCTGTTCTTGCGAGGTTCAACGCAGTCCAACCCAGTAGCTCCGAGGAGGAGAGCTCATC
GTCCTAGCCGTTGGAGCCTGCATGTTATTGTCTGAAGAAAAGCAATGCAGGCTAGGACTT
TAGAATCACATAAGTATTTTGTAACTGTAGCAGATAAGTGTAGATCAAAGTCTATATGTA
CTAGTACATGATTCAGCATGCTAAGCATCATCCCAGCCAATGGCCTACCAAAGGTGAAAG
TGGCATTGTACATGATTCAGCATGCTAAGAATCACTAGACAGGAGCTTTTGTGATCATGC
TGAATGCTTGAATCTCGTGATAAAAGTAAAGTACTCCTAGC

CDS

2367 bp

>Os09t0517600-01 Class I formin protein, Regulation of grain size, Control of microtubule and actin filament cytoskeleton systems
ATGCTCGCGCGGTGGCTGCTCGTGCTGCTCCTCTTGCTGCCTGTTTCTTGGTGTCATCAA
GATCGGCATGGCCGCCGCCATTACCCGCGGCGGTGGAGGAGCAGCGGCAGTAGGAGGGAG
CTGCACGAGCCGCTGTTCCCTCTCGAGAACGCGCCCGCGCTGCCACCGCCGCCGCCGCCG
CCACCGGCGCCGTTCTTTCCGTTCTTGCCTGACTCCGCCCCGCCGCAGCTGCCACCGCCG
GTGACCACGCCCGCTCCCGCCGGTGGCGCCGGAGATGGTGGTACGGACGCAGGCGCCGCC
GCCACCGGGGACGCGTCTTCGTCTTCGTCCTCGTCGGCGTCGCCGCACCCCACGGcgccg
gcgaacatctcgtacatggccatgcccatctaccactccgcgccgctccgctccttcctg
tcgtcgcaccgcctcctcaccgtcctcctcccggtcgccgccgtcctcgccgccgtgcta
gccgcggcgctcgtctacctcctcacgcgacgccgccgCTGCTCCAAGGGGGAGCCGCAC
GCGGCGCATACGAAGGCCGTGCTGCTTTCCCCGGGGAACTCCACGGCGCTCTACGACGGC
GACCACGACCAGCATGGCCGGGGGTCCACCGCCACCGCAGCCTCCAGCGCCAGCTCGCCG
GAACTCCGGCCGATGCCGCCTCTACCCCGGCAGTTCCAGCAGACGAGGACGAGCATGCCG
TCAACTTCGCAAACCATCCATGAAGCCGGAGCAGAGGACAAGCGAGCGCCGCCACCGCAG
AGTGTTCGACCGCCGCCGCCACCACCACCACCTCCTCCTCCGCCGCCAATGCCGCCGAGA
ACGGACAACGCGAGCACGCAAGCAGCGCCCGCGCCTCCCCCGCCATTGCCGCgagccggc
aacggcagcggctggctgccacggcggtacacggagcgcgccgcgccgacggtgatcagg
gcctcggcgggggcagtccacccggaggagtcgccggcgcgcgCCTCGCCGGAGGAGAAG
GCCGCCGACGCGGCCGCTCGGCCGAAGCTGAAGCCGCTGCACTGGGACAAGGTGCGGCCG
GCGAGCTCCGGCCGGCCGACGGTGTGGGACCAGCTGAAGGCGAGCTCATTCCGAGTGAAC
GAAGAGATGATCGAGACGCTCTTCGTCTCCAACTCGACGAGGAGAGCATCCAAGAATGGA
GTCAAGGAGGCAAATGCAGCTTGCTGCAACCAGGAGAACAAGGTGCTGGACCCGAAGAAA
TCGCAGAACATCGCGATCATGCTGAGGGCGCTCGACGCGACGAAGGAGGAAGTCTGCAAG
GCTCTCCTGGATGGCCAGGCAGAGAGCCTTGGAACTGAGCTGCTGGAGACACTTCTAAAG
ATGGCTCCTAGCAGAGAAGAGGAAATCAAGCTGAAGGAATTCAGGGAGGATGCCGTATCT
AAGCTCGGCCCTGCCGAAAGCTTCCTCAAGGCGGTGCTTGCGATACCATTTGCGTTCAAG
AGGGTCGAAGCAATGCTCTACATCGCCAACTTCGATTCGGAGGTTGACTACCTCAAGACC
TCCTTCAAAACTCTTGAGGCAGCATGTGAAGAGCTGAGGGGCAGCAGGTTGTTCCACAAG
ATCTTAGATGCAGTGCTGAAGACCGGTAACCGCATGAACACtggcaccaaccgcggaaat
gcaagcgccttcaagcttgatgccctcctcaagttagtcgacgtaaagggtgcagatggc
aagacaacccttctgcattttgttatcgaagagattgtcaagtccgaaggtGCCAGCATC
TTGGCCACTGGCCAAACATCCAACCAGGGGAGTGCCATTGCAGATGATTTCCAGTGCAAG
AAGGTTGGCCTCAGAATTGTTGCTAGCCTTGGTGGTGAGCTCGGCAATGTCAAGAAGGCA
GCTGGAATGGACTCAGACACACTGGCCAGCTGCGTTGCCAAGCTTTCTGCTGGTGTTAGC
AAGATCAGTGAGGCCCTGCAGCTGAACCAGCAGCTCGGTTCCGATGATCATTGCAAGAGA
TTCCGCGCCTCAATCGGTGAGTTCCTGCAGAAGGCCGAAGCTGAGATCACCGCAGTGCAG
GCTCAGGAGAGCCTCGCCCTCTCCCTCGTCAGGGAGACGACCGAGTTCTTCCACGGTGAC
TCGGTGAAGGAGGAAGGGCACCCTCTGAGAATCTTCATGGTGGTGCGCGACTTCCTCACC
GTTCTTGATCATGTCTGCAAGGATGTCGGCAGGATGAACGAAAGAACAGCGATTGGATCT
TCGCTCCGGCTGGAGAATGCACCTGTTCTTGCGAGGTTCAACGCAGTCCAACCCAGTAGC
TCCGAGGAGGAGAGCTCATCGTCCTAG

Protein

789 aa

>Os09t0517600-01 Class I formin protein, Regulation of grain size, Control of microtubule and actin filament cytoskeleton systems
MLARWLLVLLLLLPVSWCHQDRHGRRHYPRRWRSSGSRRELHEPLFPLENAPALPPPPPP
PPAPFFPFLPDSAPPQLPPPVTTPAPAGGAGDGGTDAGAAATGDASSSSSSSASPHPTAP
ANISYMAMPIYHSAPLRSFLSSHRLLTVLLPVAAVLAAVLAAALVYLLTRRRRCSKGEPH
AAHTKAVLLSPGNSTALYDGDHDQHGRGSTATAASSASSPELRPMPPLPRQFQQTRTSMP
STSQTIHEAGAEDKRAPPPQSVRPPPPPPPPPPPPPMPPRTDNASTQAAPAPPPPLPRAG
NGSGWLPRRYTERAAPTVIRASAGAVHPEESPARASPEEKAADAAARPKLKPLHWDKVRP
ASSGRPTVWDQLKASSFRVNEEMIETLFVSNSTRRASKNGVKEANAACCNQENKVLDPKK
SQNIAIMLRALDATKEEVCKALLDGQAESLGTELLETLLKMAPSREEEIKLKEFREDAVS
KLGPAESFLKAVLAIPFAFKRVEAMLYIANFDSEVDYLKTSFKTLEAACEELRGSRLFHK
ILDAVLKTGNRMNTGTNRGNASAFKLDALLKLVDVKGADGKTTLLHFVIEEIVKSEGASI
LATGQTSNQGSAIADDFQCKKVGLRIVASLGGELGNVKKAAGMDSDTLASCVAKLSAGVS
KISEALQLNQQLGSDDHCKRFRASIGEFLQKAEAEITAVQAQESLALSLVRETTEFFHGD
SVKEEGHPLRIFMVVRDFLTVLDHVCKDVGRMNERTAIGSSLRLENAPVLARFNAVQPSS
SEEESSSS*

5'UTR

chr09:20179714..20179933 (+ strand) : 220 bp

CDS

chr09:20179934..20181066 (+ strand) : 1133 bp

chr09:20181176..20181375 (+ strand) : 200 bp

chr09:20181488..20181732 (+ strand) : 245 bp

chr09:20181946..20182734 (+ strand) : 789 bp

3'UTR

chr09:20182735..20183008 (+ strand) : 274 bp

FASTA

>Os09t0517600-01 class=Sequence position=chr09:20179714..20183008 (+ strand)
GCTCCCCTCG CCTACCCACA GCTGTTCACA TCACTCCCGC TCCTCGAGAA CACCACTCCC TCCTACTAGT AGCTTCTCTC
TCTCTCTCTT CTTCTTCCTC GCTTTGCTTG GGTTGGGTTG GAGCGGTGAG ACGAGAGATT GAGGGGAGGA GAGGAGAGGA
CAGCAGCTGC CCCTCGATTC GATTCTTGAG TGATCATCTT GGGCTTGGGC GTTGGCGCCA ATGCTCGCGC GGTGGCTGCT
CGTGCTGCTC CTCTTGCTGC CTGTTTCTTG GTGTCATCAA GATCGGCATG GCCGCCGCCA TTACCCGCGG CGGTGGAGGA
GCAGCGGCAG TAGGAGGGAG CTGCACGAGC CGCTGTTCCC TCTCGAGAAC GCGCCCGCGC TGCCACCGCC GCCGCCGCCG
CCACCGGCGC CGTTCTTTCC GTTCTTGCCT GACTCCGCCC CGCCGCAGCT GCCACCGCCG GTGACCACGC CCGCTCCCGC
CGGTGGCGCC GGAGATGGTG GTACGGACGC AGGCGCCGCC GCCACCGGGG ACGCGTCTTC GTCTTCGTCC TCGTCGGCGT
CGCCGCACCC CACGGcgccg gcgaacatct cgtacatggc catgcccatc taccactccg cgccgctccg ctccttcctg
tcgtcgcacc gcctcctcac cgtcctcctc ccggtcgccg ccgtcctcgc cgccgtgcta gccgcggcgc tcgtctacct
cctcacgcga cgccgccgCT GCTCCAAGGG GGAGCCGCAC GCGGCGCATA CGAAGGCCGT GCTGCTTTCC CCGGGGAACT
CCACGGCGCT CTACGACGGC GACCACGACC AGCATGGCCG GGGGTCCACC GCCACCGCAG CCTCCAGCGC CAGCTCGCCG
GAACTCCGGC CGATGCCGCC TCTACCCCGG CAGTTCCAGC AGACGAGGAC GAGCATGCCG TCAACTTCGC AAACCATCCA
TGAAGCCGGA GCAGAGGACA AGCGAGCGCC GCCACCGCAG AGTGTTCGAC CGCCGCCGCC ACCACCACCA CCTCCTCCTC
CGCCGCCAAT GCCGCCGAGA ACGGACAACG CGAGCACGCA AGCAGCGCCC GCGCCTCCCC CGCCATTGCC GCgagccggc
aacggcagcg gctggctgcc acggcggtac acggagcgcg ccgcgccgac ggtgatcagg gcctcggcgg gggcagtcca
cccggaggag tcgccggcgc gcgCCTCGCC GGAGGAGAAG GCCGCCGACG CGGCCGCTCG GCCGAAGCTG AAGCCGCTGC
ACTGGGACAA GGTGCGGCCG GCGAGCTCCG GCCGGCCGAC GGTGTGGGAC CAGCTGAAGG CGAGCTCATT CCGGTGAGCT
CCCCACGCGA TATCGCTTCT TGGTGATTGG ATTTAGCAGC AGCCATGATC ACTTAGCTCT GATACTGAAG AGCTGCAATC
TTGTTTGCTT GTGTATGAGC AGAGTGAACG AAGAGATGAT CGAGACGCTC TTCGTCTCCA ACTCGACGAG GAGAGCATCC
AAGAATGGAG TCAAGGAGGC AAATGCAGCT TGCTGCAACC AGGAGAACAA GGTGCTGGAC CCGAAGAAAT CGCAGAACAT
CGCGATCATG CTGAGGGCGC TCGACGCGAC GAAGGAGGAA GTCTGCAAGG CTCTCCTGGA TGGTGAGCTG AGATATTGGC
AATGATAATC TTTAGAATTT GAGCTAACCC TGCATTCAGA GAATGCTTTG TCTGATCGTC AAGTTTCTGA ACATTTCGCC
ATTGTTGGGA GCAGGCCAGG CAGAGAGCCT TGGAACTGAG CTGCTGGAGA CACTTCTAAA GATGGCTCCT AGCAGAGAAG
AGGAAATCAA GCTGAAGGAA TTCAGGGAGG ATGCCGTATC TAAGCTCGGC CCTGCCGAAA GCTTCCTCAA GGCGGTGCTT
GCGATACCAT TTGCGTTCAA GAGGGTCGAA GCAATGCTCT ACATCGCCAA CTTCGATTCG GAGGTTGACT ACCTCAAGAC
CTCCTTCAAA ACTCTTGAGG TACTAGTTAT GTCCTGCCTT GTCCTAGCAG GTTCCATTAG TTGTTTTGAA TGAAATAGAA
GTACAAATAT GCTCTGAGTC GAATCAAAGT CGGTGCAGTT TTCCCGAGTT TCATGTTACT ACAGTTAATA GGAATAGGGT
GAAGAGCAAT TTATTGGCAA CATTATGAGT TACGGATGAT GAAGATGTTG CAACTGTGCA TTGCTATTGC AGGCAGCATG
TGAAGAGCTG AGGGGCAGCA GGTTGTTCCA CAAGATCTTA GATGCAGTGC TGAAGACCGG TAACCGCATG AACACtggca
ccaaccgcgg aaatgcaagc gccttcaagc ttgatgccct cctcaagtta gtcgacgtaa agggtgcaga tggcaagaca
acccttctgc attttgttat cgaagagatt gtcaagtccg aaggtGCCAG CATCTTGGCC ACTGGCCAAA CATCCAACCA
GGGGAGTGCC ATTGCAGATG ATTTCCAGTG CAAGAAGGTT GGCCTCAGAA TTGTTGCTAG CCTTGGTGGT GAGCTCGGCA
ATGTCAAGAA GGCAGCTGGA ATGGACTCAG ACACACTGGC CAGCTGCGTT GCCAAGCTTT CTGCTGGTGT TAGCAAGATC
AGTGAGGCCC TGCAGCTGAA CCAGCAGCTC GGTTCCGATG ATCATTGCAA GAGATTCCGC GCCTCAATCG GTGAGTTCCT
GCAGAAGGCC GAAGCTGAGA TCACCGCAGT GCAGGCTCAG GAGAGCCTCG CCCTCTCCCT CGTCAGGGAG ACGACCGAGT
TCTTCCACGG TGACTCGGTG AAGGAGGAAG GGCACCCTCT GAGAATCTTC ATGGTGGTGC GCGACTTCCT CACCGTTCTT
GATCATGTCT GCAAGGATGT CGGCAGGATG AACGAAAGAA CAGCGATTGG ATCTTCGCTC CGGCTGGAGA ATGCACCTGT
TCTTGCGAGG TTCAACGCAG TCCAACCCAG TAGCTCCGAG GAGGAGAGCT CATCGTCCTA GCCGTTGGAG CCTGCATGTT
ATTGTCTGAA GAAAAGCAAT GCAGGCTAGG ACTTTAGAAT CACATAAGTA TTTTGTAACT GTAGCAGATA AGTGTAGATC
AAAGTCTATA TGTACTAGTA CATGATTCAG CATGCTAAGC ATCATCCCAG CCAATGGCCT ACCAAAGGTG AAAGTGGCAT
TGTACATGAT TCAGCATGCT AAGAATCACT AGACAGGAGC TTTTGTGATC ATGCTGAATG CTTGAATCTC GTGATAAAAG
TAAAGTACTC CTAGC

Locus: Os09g0517600

Loading...

Locus: Os09g0517600

Loading...