Os09t0518200-01

Locus

Os09g0518200

Description

UDP-glucuronosyl/UDP-glucosyltransferase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSGT, SGT, UGT74H3

Oryzabase Gene Name Synonym(s)

salicylic acid glucosyltransferase, SA-glucosyltransferase, UDP-glucose-dependent glycosyltransferase 74H3

Transcript Evidence

AK064395 (DDBJ, Best hit)

AK121725 (DDBJ, Best hit)

Protein Evidence

NP_001150551.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: transferase activity, transferring hexosyl groups (GO:0016758)

Functional domain (InterPro)

UDP-glucuronosyl/UDP-glucosyltransferase (IPR002213)

Full-length cDNA

002-108-G04 (Online Clone Ordering)

J033082A13 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0518200-01)

Others

Oryzabase (9968)

Transcript

1727 bp

>Os09t0518200-01 UDP-glucuronosyl/UDP-glucosyltransferase family protein.
GTGCAAGCGTATCACAGTTCACAAAAGCAGCACAGAGCTAGTCTAGTGGCAGCCATGGCG
AGCTCAGAGCGCGGCGGCGGCGGCGGCATCCACGTCGTCTTGCTCCCGTACCCGAGCCAA
ggccacatcaatccgatcctccagttcggcaagcgcctcgccggccatggcggcgtccgg
tgcaccctcgccgtgacgcggttcatcctccgccagggcgagccgccgtccacgggcgcc
gtccacgtcgccgcctactccgacggctacgacgccggcggcttccacgaggccggcagc
gccgGCGAGTACCTGTCCCGGCTGGAGTCGCGCGGGTCGGACACCATGGACGCGCTCCTC
CGCGCCGAGGCGGAGCAGGGCCGGCCGGTGGACGCGGTGGTGTACGACTCGTTCCTGAGC
TGGGCGCCGCGCGTGGCGGCGCGCCACGGTGCGGCGACCGCGTCCTTCTTCACGCAGGCG
TGCGCGGTGAACGCGGCGTACGAGAGCGTGTTCACGGGCCGGGTCGAGCTGCCGCTCGCC
GCCGACGGCGAGGAGCCGCTACGGCTGCCCGGGATTTCCGTCGGCCTCACGCTGGACGAC
GTGCCGACGTTCATGGCGAACACGGAGGACAGCCCGGCGTACCTCGACCTCCTGGTGAAC
CAGTTCAAGGGCCTGGACATGGCCGACCATGTCCTCGTCAACTCCTTCTACGAGCTCCAG
CCACAGGAAGCGGAGCACATGGCGTCGGCGTGGCGGGCCAAGACGGTGGGGCTGACCGTG
CCATCGGCGTACCTCGACAACCGCCTCCCGGACGACACGTCGTACGGCTTCCACCTCTTC
TCGCCGACGACGGAGACGAAggcctggctggaggcgagaccaccgcgcaccgtggcgtac
gtctccttcggcagcgtggcgacgccgagcccggcgcagatggccgaggtggcggagggt
ttgtacaacaccggcaagcccttcctctgggtggtgagggcatcggaaacctccaagata
ccggaaggcttcgccgccaaggcggcgaagcaagggagagggctcatcgtgacgtggtgc
ccgcagctggaggtgctggcacacccagctgtggggtgcttcgtgacgcactgcgggtgg
aactcaacgacagaggggttgagtgccggtgtaccaatggtggcggtaccgcagtggtca
gaccagacaatgaatgccaagtacattgaggacgtgtggcgtgttggggtgcgggtgcgg
cccgacggcgagggggtggtgaggaaggaggagttggagaggtgtgtgagggaggtgatg
gaaggggagaggagcaaggagttcatggagaATGCTAATGGTTGGAAGGAGAAGGCCAGA
AATGCCATGTGTGAAGGTGGCAGCTCCGACAAAAATATCGTCGAGTTCATCGCTAAGATT
GGAGTGGACCGAAAATTTAAATGATTGAGACAGGTGGATTCGTCGGCCATTGGTCATGTT
TCCTTTCTCATTTGATTTCACTATCATGTTTTCAGATGCAATAATAGTCGTTATCTGTCG
CTCTAGTCTTTCTTTTTCTAGTATAGGATCAAATATTTGCGATATCTTTTTCCCACTATA
TTCAATGAAATGGGCACAGTCGGATGCCGATTCGTTAAAAAAATATTTTACGATATGTAT
AGTAAAATAATCAGTCATCAGTCAATGCATTAATTGCATAGTTGTTC

CDS

1410 bp

>Os09t0518200-01 UDP-glucuronosyl/UDP-glucosyltransferase family protein.
ATGGCGAGCTCAGAGCGCGGCGGCGGCGGCGGCATCCACGTCGTCTTGCTCCCGTACCCG
AGCCAAggccacatcaatccgatcctccagttcggcaagcgcctcgccggccatggcggc
gtccggtgcaccctcgccgtgacgcggttcatcctccgccagggcgagccgccgtccacg
ggcgccgtccacgtcgccgcctactccgacggctacgacgccggcggcttccacgaggcc
ggcagcgccgGCGAGTACCTGTCCCGGCTGGAGTCGCGCGGGTCGGACACCATGGACGCG
CTCCTCCGCGCCGAGGCGGAGCAGGGCCGGCCGGTGGACGCGGTGGTGTACGACTCGTTC
CTGAGCTGGGCGCCGCGCGTGGCGGCGCGCCACGGTGCGGCGACCGCGTCCTTCTTCACG
CAGGCGTGCGCGGTGAACGCGGCGTACGAGAGCGTGTTCACGGGCCGGGTCGAGCTGCCG
CTCGCCGCCGACGGCGAGGAGCCGCTACGGCTGCCCGGGATTTCCGTCGGCCTCACGCTG
GACGACGTGCCGACGTTCATGGCGAACACGGAGGACAGCCCGGCGTACCTCGACCTCCTG
GTGAACCAGTTCAAGGGCCTGGACATGGCCGACCATGTCCTCGTCAACTCCTTCTACGAG
CTCCAGCCACAGGAAGCGGAGCACATGGCGTCGGCGTGGCGGGCCAAGACGGTGGGGCTG
ACCGTGCCATCGGCGTACCTCGACAACCGCCTCCCGGACGACACGTCGTACGGCTTCCAC
CTCTTCTCGCCGACGACGGAGACGAAggcctggctggaggcgagaccaccgcgcaccgtg
gcgtacgtctccttcggcagcgtggcgacgccgagcccggcgcagatggccgaggtggcg
gagggtttgtacaacaccggcaagcccttcctctgggtggtgagggcatcggaaacctcc
aagataccggaaggcttcgccgccaaggcggcgaagcaagggagagggctcatcgtgacg
tggtgcccgcagctggaggtgctggcacacccagctgtggggtgcttcgtgacgcactgc
gggtggaactcaacgacagaggggttgagtgccggtgtaccaatggtggcggtaccgcag
tggtcagaccagacaatgaatgccaagtacattgaggacgtgtggcgtgttggggtgcgg
gtgcggcccgacggcgagggggtggtgaggaaggaggagttggagaggtgtgtgagggag
gtgatggaaggggagaggagcaaggagttcatggagaATGCTAATGGTTGGAAGGAGAAG
GCCAGAAATGCCATGTGTGAAGGTGGCAGCTCCGACAAAAATATCGTCGAGTTCATCGCT
AAGATTGGAGTGGACCGAAAATTTAAATGA

Protein

470 aa

>Os09t0518200-01 UDP-glucuronosyl/UDP-glucosyltransferase family protein.
MASSERGGGGGIHVVLLPYPSQGHINPILQFGKRLAGHGGVRCTLAVTRFILRQGEPPST
GAVHVAAYSDGYDAGGFHEAGSAGEYLSRLESRGSDTMDALLRAEAEQGRPVDAVVYDSF
LSWAPRVAARHGAATASFFTQACAVNAAYESVFTGRVELPLAADGEEPLRLPGISVGLTL
DDVPTFMANTEDSPAYLDLLVNQFKGLDMADHVLVNSFYELQPQEAEHMASAWRAKTVGL
TVPSAYLDNRLPDDTSYGFHLFSPTTETKAWLEARPPRTVAYVSFGSVATPSPAQMAEVA
EGLYNTGKPFLWVVRASETSKIPEGFAAKAAKQGRGLIVTWCPQLEVLAHPAVGCFVTHC
GWNSTTEGLSAGVPMVAVPQWSDQTMNAKYIEDVWRVGVRVRPDGEGVVRKEELERCVRE
VMEGERSKEFMENANGWKEKARNAMCEGGSSDKNIVEFIAKIGVDRKFK*

5'UTR

chr09:20222176..20222229 (+ strand) : 54 bp

CDS

chr09:20222230..20222901 (+ strand) : 672 bp

chr09:20222992..20223729 (+ strand) : 738 bp

3'UTR

chr09:20223730..20223992 (+ strand) : 263 bp

FASTA

>Os09t0518200-01 class=Sequence position=chr09:20222176..20223992 (+ strand)
GTGCAAGCGT ATCACAGTTC ACAAAAGCAG CACAGAGCTA GTCTAGTGGC AGCCATGGCG AGCTCAGAGC GCGGCGGCGG
CGGCGGCATC CACGTCGTCT TGCTCCCGTA CCCGAGCCAA ggccacatca atccgatcct ccagttcggc aagcgcctcg
ccggccatgg cggcgtccgg tgcaccctcg ccgtgacgcg gttcatcctc cgccagggcg agccgccgtc cacgggcgcc
gtccacgtcg ccgcctactc cgacggctac gacgccggcg gcttccacga ggccggcagc gccgGCGAGT ACCTGTCCCG
GCTGGAGTCG CGCGGGTCGG ACACCATGGA CGCGCTCCTC CGCGCCGAGG CGGAGCAGGG CCGGCCGGTG GACGCGGTGG
TGTACGACTC GTTCCTGAGC TGGGCGCCGC GCGTGGCGGC GCGCCACGGT GCGGCGACCG CGTCCTTCTT CACGCAGGCG
TGCGCGGTGA ACGCGGCGTA CGAGAGCGTG TTCACGGGCC GGGTCGAGCT GCCGCTCGCC GCCGACGGCG AGGAGCCGCT
ACGGCTGCCC GGGATTTCCG TCGGCCTCAC GCTGGACGAC GTGCCGACGT TCATGGCGAA CACGGAGGAC AGCCCGGCGT
ACCTCGACCT CCTGGTGAAC CAGTTCAAGG GCCTGGACAT GGCCGACCAT GTCCTCGTCA ACTCCTTCTA CGAGCTCCAG
CCACAGGTAT ATATACGTGA TCTGATCCAA GCTCGCCATA AATTTGTCCA TGGCGTGTGC AAGCCGATCA CGATCAATGT
CGTCGCCTGT TGGTAGGAAG CGGAGCACAT GGCGTCGGCG TGGCGGGCCA AGACGGTGGG GCTGACCGTG CCATCGGCGT
ACCTCGACAA CCGCCTCCCG GACGACACGT CGTACGGCTT CCACCTCTTC TCGCCGACGA CGGAGACGAA ggcctggctg
gaggcgagac caccgcgcac cgtggcgtac gtctccttcg gcagcgtggc gacgccgagc ccggcgcaga tggccgaggt
ggcggagggt ttgtacaaca ccggcaagcc cttcctctgg gtggtgaggg catcggaaac ctccaagata ccggaaggct
tcgccgccaa ggcggcgaag caagggagag ggctcatcgt gacgtggtgc ccgcagctgg aggtgctggc acacccagct
gtggggtgct tcgtgacgca ctgcgggtgg aactcaacga cagaggggtt gagtgccggt gtaccaatgg tggcggtacc
gcagtggtca gaccagacaa tgaatgccaa gtacattgag gacgtgtggc gtgttggggt gcgggtgcgg cccgacggcg
agggggtggt gaggaaggag gagttggaga ggtgtgtgag ggaggtgatg gaaggggaga ggagcaagga gttcatggag
aATGCTAATG GTTGGAAGGA GAAGGCCAGA AATGCCATGT GTGAAGGTGG CAGCTCCGAC AAAAATATCG TCGAGTTCAT
CGCTAAGATT GGAGTGGACC GAAAATTTAA ATGATTGAGA CAGGTGGATT CGTCGGCCAT TGGTCATGTT TCCTTTCTCA
TTTGATTTCA CTATCATGTT TTCAGATGCA ATAATAGTCG TTATCTGTCG CTCTAGTCTT TCTTTTTCTA GTATAGGATC
AAATATTTGC GATATCTTTT TCCCACTATA TTCAATGAAA TGGGCACAGT CGGATGCCGA TTCGTTAAAA AAATATTTTA
CGATATGTAT AGTAAAATAA TCAGTCATCA GTCAATGCAT TAATTGCATA GTTGTTC