Os09t0521900-01

Locus

Os09g0521900

Description

Holliday junction resolvase, 5'-flap endonuclease, Homologous recombinational DNA repair, Microspore development

RAP-DB Gene Symbol Synonym(s)

RAD, OsGEN1, rad, rad*, OsRAD, GEN1, OsGEN-L

RAP-DB Gene Name Synonym(s)

REDUCED ADH ACTIVITY, reduced ADH activity, Flap endonuclease GEN-like 1, Protein OsGEN-like, OsGEN-like

CGSNL Gene Symbol

RAD

CGSNL Gene Name

REDUCED ADH ACTIVITY

Oryzabase Gene Symbol Synonym(s)

rad, rad*, OsRAD, GEN1, OsGEN-L, OsGEN1

Oryzabase Gene Name Synonym(s)

reduced ADH activity, Flap endonuclease GEN-like 1, Protein OsGEN-like, OsGEN-like

Transcript Evidence

AK063534

Protein Evidence

Q64MA3

Literature

PMID: 28049740

PMID: 22247560

PMID: 15792960

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

February 7, 2017

Gene Ontology (GO)

Biological Process: DNA repair (GO:0006281)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: nuclease activity (GO:0004518)

Functional domain (InterPro)

XPG/Rad2 endonuclease (IPR006084)

XPG N-terminal (IPR006085)

PIN domain-like (IPR029060)

XPG-I domain (IPR006086)

5'-3' exonuclease, C-terminal domain (IPR020045)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

001-117-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0521900-01)

Others

Oryzabase (2065)

Transcript

2252 bp

>Os09t0521900-01 Holliday junction resolvase, 5'-flap endonuclease, Homologous recombinational DNA repair, Microspore development
ACCTGCAGCGACCCAACCCGACCCAACCCAACTCGCGCGAGCCCTGCGGTTTCGCCGGCG
AAACGAGGCCGACCTAAACCCTCCGCCGCCGCCGCCGCCGTCGCCGGGGAAGAAGAGAGA
TGGGGGTGGGGGGAAGCTTCTGGGACCTGCTCAAGCCGTACGCGCGGCACGAGGGCGcgg
ggtacctccgcggccgccgcgtcgccgtcgacctctccttctgggtcgtctcccacagcg
ccgccatccgggcgcgctcgccgcacgcgcgcctcccccatctccgcaccctcttcttcc
gcaccctctccctcttctccaagATGGGTGCTTTTCCTGTGTTCGTGGTGGACGGCCAGC
CGTCGCCGCTCAAGTCGCAGGTGAGGGCCGCGCGATTCTTCAGAGGATCTGGAATGGACC
TCGCTGCGCTGCCGAGCACGGAGGCGGAGGCCAGTGCGGATGCGCTGGTTCAACCGAGGA
ATGCCAAGTTCACGCGATACGTGGAGGATTGCGTGGAACTGCTTGAATATCTTGGAATGC
CTGTGCTGCGGGCAAAAGGTGAAGGTGAAGCTCTTTGTGCTCAGTTGAATAATCAAGGCC
ATGTAGATGCTTGCATCACTTCAGACAGTGACGCTTTCCTCTTTGGGGCTAAGACTGTCA
TAAAGGTTCTCCGATCGAATTGTAAGGAACCTTTTGAGTGCTACAACATGGCAGACATTG
AGTCTGGTCTTGGACTAAAGAGGAAACAAATGGTAGCAATGGCACTTCTTGTTGGCAGTG
ACCATGACTTGCATGGTGTGCCTGGTTTTGGTCCTGAGACTGCACTTCGGTTTGTGCAGT
TATTTGATGAAGATAATGTTCTAGCTAAATTATATGAAATTGGTAAAGGGGTCTATCCAT
TTATAGGAGTTAGTGCGCCCAATATTGATGATCTCCCATCACCCTCCACAAAGAGTCTAC
CGCGTGCGCGATCACCGCACTGCTCACATTGTGGTCACCCTGGCAACAAGAAAAATCATA
TCAAGGATGGGTGCAACTTTTGCTTGGTTGATTCATTAGAGAATTGTGTGGAGAAGCCAG
CTGGATTCATATGTGAATGTCCTAGTTGTGACAAGGCACGTGATCTGAAGGTGCAGAGAA
GAAATGAAAACTGGCAAATCAAGGTCTGTAAAAGGATAGCTGCTGAGACTAACTTTCCAA
ATGAGGAGATCATTAACTTGTACTTGAATGATGACAATTTGGATAATGaaaatggtgttc
cattgcttacatggaataaacctgatatggagattttggttgacttcttatctttcaagc
agaactgggagccagcgtatattcgtcagcggatgcttcctatgctatcaaccatatatt
tacgcgaaatggcttcatctcaatctaaatcatttcttctttatgatcaatataaatttc
attcaatccaacggattaagataagatatggtcacccatattacttggtcaagtggaaga
gagtcactcgtagtatgatatccaatgatccacctagcaagcagacagaattggagggga
agaatgataaggtggaggtattggatggagatgatgaggtagtagatgaagaggaggagg
agcctacaatgatttccgaaactactgaactgctagatgagccagatgttccacaagtac
tggatgatgataaagattgctttttattaactgatgaagacattgagctagtgaatgctg
catttcctgatgaagcacaaagatttcaggaagaacagAGGCTGAAAGAAGCAAAGTCAA
TAGCACGGAAATCCAAGCTCAACGTGGCAGGTTTCGAAACACCAAAAGGTCCAAGGCCTA
GTGGAGTTCAGCTTAGCATCAAGGAGTTCTACCGCTCCAAGAAAGGGCTGAGTGGCGACT
CAGGGAAGGACGGCTCAAGAAAATCCTCCGATGTGGACCTCAGCAAGAACTTGCCCAAGT
CTGTCCGACGACGCCTCCTCTTCGACTGACTGACAATTGGTCTCCCTTCTGTCTTCCCAG
TAGTCCTGCTGCTACTGTTGTACATGTTCCAGTAACATTTCTTTCGGCCAATGGATGTAC
ATTGCGTGGCCCGGTTTTTGTACAGGGAACATGCATGTCTTGTAGCTGATGAGAAACAGT
GTTTTGGGGGTTGAATCTTGTATCTGCTGCAACCATGTATATTTCATGCCATATCGCATC
ACTGCTTGCGTAGCATGGAAGAATTGGACCTG

CDS

1890 bp

>Os09t0521900-01 Holliday junction resolvase, 5'-flap endonuclease, Homologous recombinational DNA repair, Microspore development
ATGGGGGTGGGGGGAAGCTTCTGGGACCTGCTCAAGCCGTACGCGCGGCACGAGGGCGcg
gggtacctccgcggccgccgcgtcgccgtcgacctctccttctgggtcgtctcccacagc
gccgccatccgggcgcgctcgccgcacgcgcgcctcccccatctccgcaccctcttcttc
cgcaccctctccctcttctccaagATGGGTGCTTTTCCTGTGTTCGTGGTGGACGGCCAG
CCGTCGCCGCTCAAGTCGCAGGTGAGGGCCGCGCGATTCTTCAGAGGATCTGGAATGGAC
CTCGCTGCGCTGCCGAGCACGGAGGCGGAGGCCAGTGCGGATGCGCTGGTTCAACCGAGG
AATGCCAAGTTCACGCGATACGTGGAGGATTGCGTGGAACTGCTTGAATATCTTGGAATG
CCTGTGCTGCGGGCAAAAGGTGAAGGTGAAGCTCTTTGTGCTCAGTTGAATAATCAAGGC
CATGTAGATGCTTGCATCACTTCAGACAGTGACGCTTTCCTCTTTGGGGCTAAGACTGTC
ATAAAGGTTCTCCGATCGAATTGTAAGGAACCTTTTGAGTGCTACAACATGGCAGACATT
GAGTCTGGTCTTGGACTAAAGAGGAAACAAATGGTAGCAATGGCACTTCTTGTTGGCAGT
GACCATGACTTGCATGGTGTGCCTGGTTTTGGTCCTGAGACTGCACTTCGGTTTGTGCAG
TTATTTGATGAAGATAATGTTCTAGCTAAATTATATGAAATTGGTAAAGGGGTCTATCCA
TTTATAGGAGTTAGTGCGCCCAATATTGATGATCTCCCATCACCCTCCACAAAGAGTCTA
CCGCGTGCGCGATCACCGCACTGCTCACATTGTGGTCACCCTGGCAACAAGAAAAATCAT
ATCAAGGATGGGTGCAACTTTTGCTTGGTTGATTCATTAGAGAATTGTGTGGAGAAGCCA
GCTGGATTCATATGTGAATGTCCTAGTTGTGACAAGGCACGTGATCTGAAGGTGCAGAGA
AGAAATGAAAACTGGCAAATCAAGGTCTGTAAAAGGATAGCTGCTGAGACTAACTTTCCA
AATGAGGAGATCATTAACTTGTACTTGAATGATGACAATTTGGATAATGaaaatggtgtt
ccattgcttacatggaataaacctgatatggagattttggttgacttcttatctttcaag
cagaactgggagccagcgtatattcgtcagcggatgcttcctatgctatcaaccatatat
ttacgcgaaatggcttcatctcaatctaaatcatttcttctttatgatcaatataaattt
cattcaatccaacggattaagataagatatggtcacccatattacttggtcaagtggaag
agagtcactcgtagtatgatatccaatgatccacctagcaagcagacagaattggagggg
aagaatgataaggtggaggtattggatggagatgatgaggtagtagatgaagaggaggag
gagcctacaatgatttccgaaactactgaactgctagatgagccagatgttccacaagta
ctggatgatgataaagattgctttttattaactgatgaagacattgagctagtgaatgct
gcatttcctgatgaagcacaaagatttcaggaagaacagAGGCTGAAAGAAGCAAAGTCA
ATAGCACGGAAATCCAAGCTCAACGTGGCAGGTTTCGAAACACCAAAAGGTCCAAGGCCT
AGTGGAGTTCAGCTTAGCATCAAGGAGTTCTACCGCTCCAAGAAAGGGCTGAGTGGCGAC
TCAGGGAAGGACGGCTCAAGAAAATCCTCCGATGTGGACCTCAGCAAGAACTTGCCCAAG
TCTGTCCGACGACGCCTCCTCTTCGACTGA

Protein

630 aa

>Os09t0521900-01 Holliday junction resolvase, 5'-flap endonuclease, Homologous recombinational DNA repair, Microspore development
MGVGGSFWDLLKPYARHEGAGYLRGRRVAVDLSFWVVSHSAAIRARSPHARLPHLRTLFF
RTLSLFSKMGAFPVFVVDGQPSPLKSQVRAARFFRGSGMDLAALPSTEAEASADALVQPR
NAKFTRYVEDCVELLEYLGMPVLRAKGEGEALCAQLNNQGHVDACITSDSDAFLFGAKTV
IKVLRSNCKEPFECYNMADIESGLGLKRKQMVAMALLVGSDHDLHGVPGFGPETALRFVQ
LFDEDNVLAKLYEIGKGVYPFIGVSAPNIDDLPSPSTKSLPRARSPHCSHCGHPGNKKNH
IKDGCNFCLVDSLENCVEKPAGFICECPSCDKARDLKVQRRNENWQIKVCKRIAAETNFP
NEEIINLYLNDDNLDNENGVPLLTWNKPDMEILVDFLSFKQNWEPAYIRQRMLPMLSTIY
LREMASSQSKSFLLYDQYKFHSIQRIKIRYGHPYYLVKWKRVTRSMISNDPPSKQTELEG
KNDKVEVLDGDDEVVDEEEEEPTMISETTELLDEPDVPQVLDDDKDCFLLTDEDIELVNA
AFPDEAQRFQEEQRLKEAKSIARKSKLNVAGFETPKGPRPSGVQLSIKEFYRSKKGLSGD
SGKDGSRKSSDVDLSKNLPKSVRRRLLFD*

5'UTR

chr09:20389919..20390037 (+ strand) : 119 bp

CDS

chr09:20390038..20390241 (+ strand) : 204 bp

chr09:20390565..20390756 (+ strand) : 192 bp

chr09:20391137..20391307 (+ strand) : 171 bp

chr09:20391408..20391589 (+ strand) : 182 bp

chr09:20391682..20391928 (+ strand) : 247 bp

chr09:20392269..20392401 (+ strand) : 133 bp

chr09:20392563..20393092 (+ strand) : 530 bp

chr09:20393433..20393663 (+ strand) : 231 bp

3'UTR

chr09:20393664..20393906 (+ strand) : 243 bp

FASTA

>Os09t0521900-01 class=Sequence position=chr09:20389919..20393906 (+ strand)
ACCTGCAGCG ACCCAACCCG ACCCAACCCA ACTCGCGCGA GCCCTGCGGT TTCGCCGGCG AAACGAGGCC GACCTAAACC
CTCCGCCGCC GCCGCCGCCG TCGCCGGGGA AGAAGAGAGA TGGGGGTGGG GGGAAGCTTC TGGGACCTGC TCAAGCCGTA
CGCGCGGCAC GAGGGCGcgg ggtacctccg cggccgccgc gtcgccgtcg acctctcctt ctgggtcgtc tcccacagcg
ccgccatccg ggcgcgctcg ccgcacgcgc gcctccccca tctccgcacc ctcttcttcc gcaccctctc cctcttctcc
aaggtgagcc accccctccc ctctccccag ggtttccttc cttcccctcC GCCCCGCGAC ATGTATGTAG CTTCACTTCC
GTTTCTTGAT CTCCCCCAAG GTTTCTTGTT CTTAGTACAT TTCTAGCGTT TTATGTGATT ATGAACAATC TGCATTGCGG
AAATGTACGT TCTGTGCTGT TTTCAAGACT GAATCTTGGA TGTGCAACCG CCGTTGGGGT CTATGCTTGG GGGCATGGGG
GCTAATGCTG TTCAATGTGT TTTGATTCCT CGATTTGGGC CCGGAATTTT GATTCACGTG ATGGATTATC TCTGGAACTG
TTGCAGATGG GTGCTTTTCC TGTGTTCGTG GTGGACGGCC AGCCGTCGCC GCTCAAGTCG CAGGTGAGGG CCGCGCGATT
CTTCAGAGGA TCTGGAATGG ACCTCGCTGC GCTGCCGAGC ACGGAGGCGG AGGCCAGTGC GGATGCGCTG GTTCAACCGA
GGAATGCCAA GTTCACGCGA TACGTGGAGG ATTGCGTGGT GAGTGTCCGT GCCATGGCTG TGCTTGTGAT CCTTCCTTGT
CAGTTTAGGA TGTGTAATTT GGTCGTACAA GACAGTTCGA AGTACGATGT AATAAATTGC CGCTTAAATA CCATAGGCAT
GATTCAACAC GGTGTTTATA AGCCTCTGAA GTAATATGTT CGAAATTACT CTTATCTAAA TAAAAAGGCG GGAATTTGTC
AAGGCGCGAA GCGGGTCGGT AGAAAAGAAA ACTTTCCATA GTAGCGTCTC CCAAGTTTTG CTTAGATTAC TGATGAGCGG
GTACACGTGT TTATGTGTTT TGGGGATCTT GCTGTCGCCT GGGGTTTCTA TGGTAGTAAA GGTCATATTT AATGATGCCC
CTTATCTTAT AATTTTAGGA ACTGCTTGAA TATCTTGGAA TGCCTGTGCT GCGGGCAAAA GGTGAAGGTG AAGCTCTTTG
TGCTCAGTTG AATAATCAAG GCCATGTAGA TGCTTGCATC ACTTCAGACA GTGACGCTTT CCTCTTTGGG GCTAAGACTG
TCATAAAGGT TCTCCGATCG AATTGTAAGG TAAGCAGTTT ATCATAAATA TGTAACTGGA TTGAATTGTT TGCTTCATTT
TCTCTGTATT CTGTAATATG GTATCACGAT GTTCACCATT TTTTTTCAGG AACCTTTTGA GTGCTACAAC ATGGCAGACA
TTGAGTCTGG TCTTGGACTA AAGAGGAAAC AAATGGTAGC AATGGCACTT CTTGTTGGCA GTGACCATGA CTTGCATGGT
GTGCCTGGTT TTGGTCCTGA GACTGCACTT CGGTTTGTGC AGTTATTTGA TGAAGATAAT GTTCTAGCTA AGTATGTTTA
ATGATTTCAT TATTAGTCCT CCTAGTTTAT TTTTAGTGCA AAATGTTGAA TTTCTCTGGC TAATTGTCTC TATACTTCTC
CAGATTATAT GAAATTGGTA AAGGGGTCTA TCCATTTATA GGAGTTAGTG CGCCCAATAT TGATGATCTC CCATCACCCT
CCACAAAGAG TCTACCGCGT GCGCGATCAC CGCACTGCTC ACATTGTGGT CACCCTGGCA ACAAGAAAAA TCATATCAAG
GATGGGTGCA ACTTTTGCTT GGTTGATTCA TTAGAGAATT GTGTGGAGAA GCCAGCTGGA TTCATATGTG AATGTCCTAG
TTGTGACAAG GTAGTGCTGT TTGTTCCAGA GTATATTGTA ATTATGTATT CAACTGTCAG TTTCTATATA TTTATTTCAG
CCTGCATTCC AAATATTAGT GCGCTTAATA TACAATCTGC AATTTGTACG AGAAACTGCT GTTTACATAT GACAAATTTA
TTTGATAACT GCCTTTTGTA ACAATTATCA TATTCTCAGC AATAATCATA CCCTGTTTGT CAATGTTTCT GATGTCATCT
TTTAAACCAC ATAATGAGGC TTTATGTTGT GTATATTCTT GTATACTTCA GTGTTTCATG GAGCATAATT CTCAACATAT
TAATAATATC TTTTTTGAGA TGAATATTAG GCACGTGATC TGAAGGTGCA GAGAAGAAAT GAAAACTGGC AAATCAAGGT
CTGTAAAAGG ATAGCTGCTG AGACTAACTT TCCAAATGAG GAGATCATTA ACTTGTACTT GAATGATGAC AATTTGGATA
ATGGTATTCT TTTTCCCAAT AACACTTCTT TCAATATTTC TTACTGACGC CGTTATTTTA GAATGGGGAC TGCTTTGGCC
ATCTATATCT TGTCTCATTT TACTCTACAA TACTGTATTT GCTTGCATTG GTATCTGGTA TTTACCTCTA TGTTCAAttt
gcagaaaatg gtgttccatt gcttacatgg aataaacctg atatggagat tttggttgac ttcttatctt tcaagcagaa
ctgggagcca gcgtatattc gtcagcggat gcttcctatg ctatcaacca tatatttacg cgaaatggct tcatctcaat
ctaaatcatt tcttctttat gatcaatata aatttcattc aatccaacgg attaagataa gatatggtca cccatattac
ttggtcaagt ggaagagagt cactcgtagt atgatatcca atgatccacc tagcaagcag acagaattgg aggggaagaa
tgataaggtg gaggtattgg atggagatga tgaggtagta gatgaagagg aggaggagcc tacaatgatt tccgaaacta
ctgaactgct agatgagcca gatgttccac aagtactgga tgatgataaa gattgctttt tattaactga tgaagacatt
gagctagtga atgctgcatt tcctgatgaa gcacaaagat ttcaggaaga acaggtatgc attggttgct ttcttcagat
aatttaaaat atgcatgata cttccaggac aCATCAGTCA GTTACTGAAA TAGAAAGATG AATCATGAAT CATAAAGATA
ATTGCACTGT GTTCAATGGC CCTGTTTTAA AAATGCTAGG TTCACTTTGT TGGTGCTTTT GTCAGTTACT GCTGAGGCTT
GAATTGTCAT GTTTCTTTCT AATGTGGTAT CATATAGTTC AATCAAGTTA AATTGCTTAT AGTATATGAT TTATATATGA
CATATCAGCA TCTATTTGTT TAAAAGAAAA CTTTTGCTGA CTGCGGTTGA CACAAATGCA ACGAATTCAT GCAGAGGCTG
AAAGAAGCAA AGTCAATAGC ACGGAAATCC AAGCTCAACG TGGCAGGTTT CGAAACACCA AAAGGTCCAA GGCCTAGTGG
AGTTCAGCTT AGCATCAAGG AGTTCTACCG CTCCAAGAAA GGGCTGAGTG GCGACTCAGG GAAGGACGGC TCAAGAAAAT
CCTCCGATGT GGACCTCAGC AAGAACTTGC CCAAGTCTGT CCGACGACGC CTCCTCTTCG ACTGACTGAC AATTGGTCTC
CCTTCTGTCT TCCCAGTAGT CCTGCTGCTA CTGTTGTACA TGTTCCAGTA ACATTTCTTT CGGCCAATGG ATGTACATTG
CGTGGCCCGG TTTTTGTACA GGGAACATGC ATGTCTTGTA GCTGATGAGA AACAGTGTTT TGGGGGTTGA ATCTTGTATC
TGCTGCAACC ATGTATATTT CATGCCATAT CGCATCACTG CTTGCGTAGC ATGGAAGAAT TGGACCTG

Locus: Os09g0521900

Loading...

Locus: Os09g0521900

Loading...