Os09t0524800-01

Locus

Os09g0524800

Description

Apoptosis regulator Bcl-2 protein, BAG domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BAG1

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 1

Oryzabase Gene Symbol Synonym(s)

OsBAG1

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 1

Transcript Evidence

AK105833 (DDBJ, Best hit)

Protein Evidence

A6MD01 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

BAG domain (IPR003103)

Ubiquitin supergroup (IPR019955)

Full-length cDNA

001-203-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0524800-01)

Others

Oryzabase (11550)

Transcript

2079 bp

>Os09t0524800-01 Apoptosis regulator Bcl-2 protein, BAG domain containing protein.
GAGCGATGGTGGAAGTGGCAAGTTTGGCCGAGACGAGACGACACGACGGTTGCTTCCTTC
CTAACCAACTCCCCAACCAAGCCTCCCTCCCTCGCCGGAGCTCTCGCCACCCCGCGGCCG
CCGCCGCCGCCGCGAAACGGAGCATTTGGTTAATTGCATTGCGTCCGCGTTGGGTTTGCG
TTGCATGGTCACGCGCGCGCACGCACGCACGCGGCTTTGGGTTTTTTTTGGCGCATAAAT
ATTCCGCGGCTGCTGCTGCTGCTGCCGCTTCCTGCCTGTCCCTGAGTTGTACCCGCTCTA
TTTTTTTTTTCTCTCTCTTTCTTCTCCATCTCTCCTCCTTCCTTCCTAACCTCTCCCCAC
CTACCTCCCTGCCGCCTGATCCTGATTTCCCCAATTGAGGCCAGCGTCGAGCACCTGCAC
ACACGCACACGCTCGCTGCTGCGCCTCGATTCTCGTCCCAGATCCGCCACTCCCTTCCCC
AATTCGCCGTCACCTGCAGCTGAGTGTTGCTTGCTCGAGCTAGCTGGTGGTTCTTGCCTT
GCAGGGCGAGGCAGTGGTAGCTTGCGAGCTTTAGCTGCGGGAGCGGTTGGCTTTGGTTTT
GGTTTGGTAAATTGGTTGCGTGTGCGTGTGCGTGCCATGAGAAGATGATGCGCGCCAAGG
CGAAAGGTACATTCCCACCGGCGGCGGCGGCGATGAAGGAGAGCTCTGCTCCTCCGCCGC
CTGCTGCTGCGGCGGCGGCGGCGAGGGAGGATGAGTGGGAGGTGCGGCCAGGTGGGATGC
TGGTGCAGAAGAGGAGCCCGGACGGCGACGCCCCGGCCGCGCCCGTGCCCACCATCCGCG
TCAAGGTCAAGTTCAACGGCGTCTACCACGAGATCTACATCAACTCGCAGGCGTCCTTCG
GTGAGCTGAAGAAGCAGCTGTCGGCGCCGACGGGGCTGCACCCGGAGGACCAGAAGATCG
TTTACAAGGACAAGGAGAGGGACTCCAAGGCGTTCCTCGACATGGCCGGCGTCAAGGACC
GCTCCAAGATGGTGCTCCTCGAGGACCCAACGGCGCAGGCCAAGCGCCTCCTCGAGCAAC
GCCGCACCGACAAGGCCGAGCGCGCCGCCAAGTCCATCTCCCGCATCAGCCTCGACGTCG
ACAAGCTCGCCACCAAGGTGACGGCTCTGGAGGCCATCGTCGGCAAGGGCGGGAGGGTGG
TCGACGCCGACGTGGTCACGCTCACGGAGGCGCTGATGAACGAGCTGGTCAAGCTGGACG
CCATCGCCGCCGAGGGCGAGGTCAAGGTGCAGAGGCGAATGCAGGAGAAGCGGGTGCAGA
AGTACGTGGAGTCGCTGGACGCCATCCGCGCCAAGAACGCGGCGTCGCACAACAAGGCCA
GCGGCAACGGCCACGCCAAGCCCCGGGCGCCGCACCTCCCGCCGCCGGTGTCGCAGCGGC
GGCAGTTCCAGGCGCCGCCGCCCGCCGCGCCAACGACAACGAagaccgccgccgcgccgg
cgccgccgcccacggcgagctgggagtcgttcgacctgctgtcctcgatgccgtccacgt
cgtcgtccaccgtgacgaccaccatggccgccgcgacgaccaccaccaccacctcgccga
tcccgcggttcgattgggagctcttctagctcgctctcgctctccctctcctcCTCCTCC
GATGGGTACACTACTCTACACTACACTACACTACACACTTCACCTTTTCTTTGTCCATTC
ATCTCGTGAGCTCATTCGATCGGTCGCACTAGCACCTGATCGATCAGCAGCGCTCGCCAT
TGTTTCTTTGATTTCTTCTGTTCATTCTTCCTCTTCTTTCTTTTTTCTTCATGTTCCTTT
TTTCATTTCGAGAGTATATCTACAAAAACAAAAAAGAAGAAACACCATGGGTGATCGAGT
GTGTTCAGTACGTATGTCATCACTCAAGTCAGTTCATCAATCCAATGCATGGTCAGTCAC
ACAGCCAAAAAAGAAAAAAGTGGGTGGTATCATGACGAAGAATTTTCCGGTGACACTATA
TATATACAAAAAAAACAGCATGTATATGTGATTCGAAAC

CDS

1005 bp

>Os09t0524800-01 Apoptosis regulator Bcl-2 protein, BAG domain containing protein.
ATGATGCGCGCCAAGGCGAAAGGTACATTCCCACCGGCGGCGGCGGCGATGAAGGAGAGC
TCTGCTCCTCCGCCGCCTGCTGCTGCGGCGGCGGCGGCGAGGGAGGATGAGTGGGAGGTG
CGGCCAGGTGGGATGCTGGTGCAGAAGAGGAGCCCGGACGGCGACGCCCCGGCCGCGCCC
GTGCCCACCATCCGCGTCAAGGTCAAGTTCAACGGCGTCTACCACGAGATCTACATCAAC
TCGCAGGCGTCCTTCGGTGAGCTGAAGAAGCAGCTGTCGGCGCCGACGGGGCTGCACCCG
GAGGACCAGAAGATCGTTTACAAGGACAAGGAGAGGGACTCCAAGGCGTTCCTCGACATG
GCCGGCGTCAAGGACCGCTCCAAGATGGTGCTCCTCGAGGACCCAACGGCGCAGGCCAAG
CGCCTCCTCGAGCAACGCCGCACCGACAAGGCCGAGCGCGCCGCCAAGTCCATCTCCCGC
ATCAGCCTCGACGTCGACAAGCTCGCCACCAAGGTGACGGCTCTGGAGGCCATCGTCGGC
AAGGGCGGGAGGGTGGTCGACGCCGACGTGGTCACGCTCACGGAGGCGCTGATGAACGAG
CTGGTCAAGCTGGACGCCATCGCCGCCGAGGGCGAGGTCAAGGTGCAGAGGCGAATGCAG
GAGAAGCGGGTGCAGAAGTACGTGGAGTCGCTGGACGCCATCCGCGCCAAGAACGCGGCG
TCGCACAACAAGGCCAGCGGCAACGGCCACGCCAAGCCCCGGGCGCCGCACCTCCCGCCG
CCGGTGTCGCAGCGGCGGCAGTTCCAGGCGCCGCCGCCCGCCGCGCCAACGACAACGAag
accgccgccgcgccggcgccgccgcccacggcgagctgggagtcgttcgacctgctgtcc
tcgatgccgtccacgtcgtcgtccaccgtgacgaccaccatggccgccgcgacgaccacc
accaccacctcgccgatcccgcggttcgattgggagctcttctag

Protein

335 aa

>Os09t0524800-01 Apoptosis regulator Bcl-2 protein, BAG domain containing protein.
MMRAKAKGTFPPAAAAMKESSAPPPPAAAAAAAREDEWEVRPGGMLVQKRSPDGDAPAAP
VPTIRVKVKFNGVYHEIYINSQASFGELKKQLSAPTGLHPEDQKIVYKDKERDSKAFLDM
AGVKDRSKMVLLEDPTAQAKRLLEQRRTDKAERAAKSISRISLDVDKLATKVTALEAIVG
KGGRVVDADVVTLTEALMNELVKLDAIAAEGEVKVQRRMQEKRVQKYVESLDAIRAKNAA
SHNKASGNGHAKPRAPHLPPPVSQRRQFQAPPPAAPTTTKTAAAPAPPPTASWESFDLLS
SMPSTSSSTVTTTMAAATTTTTTSPIPRFDWELF*

5'UTR

chr09:20496268..20496911 (- strand) : 644 bp

CDS

chr09:20496012..20496267 (- strand) : 256 bp

chr09:20495632..20495888 (- strand) : 257 bp

chr09:20495407..20495553 (- strand) : 147 bp

chr09:20494970..20495314 (- strand) : 345 bp

3'UTR

chr09:20494540..20494969 (- strand) : 430 bp

FASTA

>Os09t0524800-01 class=Sequence position=chr09:20494540..20496911 (- strand)
GAGCGATGGT GGAAGTGGCA AGTTTGGCCG AGACGAGACG ACACGACGGT TGCTTCCTTC CTAACCAACT CCCCAACCAA
GCCTCCCTCC CTCGCCGGAG CTCTCGCCAC CCCGCGGCCG CCGCCGCCGC CGCGAAACGG AGCATTTGGT TAATTGCATT
GCGTCCGCGT TGGGTTTGCG TTGCATGGTC ACGCGCGCGC ACGCACGCAC GCGGCTTTGG GTTTTTTTTG GCGCATAAAT
ATTCCGCGGC TGCTGCTGCT GCTGCCGCTT CCTGCCTGTC CCTGAGTTGT ACCCGCTCTA TTTTTTTTTT CTCTCTCTTT
CTTCTCCATC TCTCCTCCTT CCTTCCTAAC CTCTCCCCAC CTACCTCCCT GCCGCCTGAT CCTGATTTCC CCAATTGAGG
CCAGCGTCGA GCACCTGCAC ACACGCACAC GCTCGCTGCT GCGCCTCGAT TCTCGTCCCA GATCCGCCAC TCCCTTCCCC
AATTCGCCGT CACCTGCAGC TGAGTGTTGC TTGCTCGAGC TAGCTGGTGG TTCTTGCCTT GCAGGGCGAG GCAGTGGTAG
CTTGCGAGCT TTAGCTGCGG GAGCGGTTGG CTTTGGTTTT GGTTTGGTAA ATTGGTTGCG TGTGCGTGTG CGTGCCATGA
GAAGATGATG CGCGCCAAGG CGAAAGGTAC ATTCCCACCG GCGGCGGCGG CGATGAAGGA GAGCTCTGCT CCTCCGCCGC
CTGCTGCTGC GGCGGCGGCG GCGAGGGAGG ATGAGTGGGA GGTGCGGCCA GGTGGGATGC TGGTGCAGAA GAGGAGCCCG
GACGGCGACG CCCCGGCCGC GCCCGTGCCC ACCATCCGCG TCAAGGTCAA GTTCAACGGC GTCTACCACG AGATCTACAT
CAACTCGCAG GCGTCCTTCG GTAATGCACG CGCCTCGCCT CGCCGCCGGC GGCGTGCGAG CGCGGCGTCT GGTTTTTTTT
TTTTTTTGGG GGAGGGGTGT GATTCGGTCG AGCAGGTGCT GATGGTGGTG GTTGGTGGTG CAGGTGAGCT GAAGAAGCAG
CTGTCGGCGC CGACGGGGCT GCACCCGGAG GACCAGAAGA TCGTTTACAA GGACAAGGAG AGGGACTCCA AGGCGTTCCT
CGACATGGCC GGCGTCAAGG ACCGCTCCAA GATGGTGCTC CTCGAGGACC CAACGGCGCA GGCCAAGCGC CTCCTCGAGC
AACGCCGCAC CGACAAGGCC GAGCGCGCCG CCAAGTCCAT CTCCCGCATC AGCCTCGACG TCGACAAGCT CGCCACCAAG
GTAATCAATC ACCACAATTT GCGGCGGCGC GGCTTCAATT TGGTTCCGAA TTAGCTGAAT TGGGCGGTGG TCTTGCAGGT
GACGGCTCTG GAGGCCATCG TCGGCAAGGG CGGGAGGGTG GTCGACGCCG ACGTGGTCAC GCTCACGGAG GCGCTGATGA
ACGAGCTGGT CAAGCTGGAC GCCATCGCCG CCGAGGGCGA GGTCAAGGTG CAGAGGCGAA TGCAGGTTAG CACACGAACT
CCAAACCGAT TCTCGTCGCC GTTTCTTGCC CGATTGATTT CCGGCGAGCT CAATTTCCGA CGAACGTCAC GTCGCAGGAG
AAGCGGGTGC AGAAGTACGT GGAGTCGCTG GACGCCATCC GCGCCAAGAA CGCGGCGTCG CACAACAAGG CCAGCGGCAA
CGGCCACGCC AAGCCCCGGG CGCCGCACCT CCCGCCGCCG GTGTCGCAGC GGCGGCAGTT CCAGGCGCCG CCGCCCGCCG
CGCCAACGAC AACGAagacc gccgccgcgc cggcgccgcc gcccacggcg agctgggagt cgttcgacct gctgtcctcg
atgccgtcca cgtcgtcgtc caccgtgacg accaccatgg ccgccgcgac gaccaccacc accacctcgc cgatcccgcg
gttcgattgg gagctcttct agctcgctct cgctctccct ctcctcCTCC TCCGATGGGT ACACTACTCT ACACTACACT
ACACTACACA CTTCACCTTT TCTTTGTCCA TTCATCTCGT GAGCTCATTC GATCGGTCGC ACTAGCACCT GATCGATCAG
CAGCGCTCGC CATTGTTTCT TTGATTTCTT CTGTTCATTC TTCCTCTTCT TTCTTTTTTC TTCATGTTCC TTTTTTCATT
TCGAGAGTAT ATCTACAAAA ACAAAAAAGA AGAAACACCA TGGGTGATCG AGTGTGTTCA GTACGTATGT CATCACTCAA
GTCAGTTCAT CAATCCAATG CATGGTCAGT CACACAGCCA AAAAAGAAAA AAGTGGGTGG TATCATGACG AAGAATTTTC
CGGTGACACT ATATATATAC AAAAAAAACA GCATGTATAT GTGATTCGAA AC

Locus: Os09g0524800

Loading...

Locus: Os09g0524800

Loading...