Os09t0524800-02

Locus

Os09g0524800

Description

Apoptosis regulator Bcl-2 protein, BAG domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BAG1

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 1

Oryzabase Gene Symbol Synonym(s)

OsBAG1

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 1

Transcript Evidence

AK060485 (DDBJ, Best hit)

Protein Evidence

A6MD01 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

BAG domain (IPR003103)

Ubiquitin supergroup (IPR019955)

Full-length cDNA

001-013-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0524800-02)

Others

Oryzabase (11550)

Transcript

1806 bp

>Os09t0524800-02 Apoptosis regulator Bcl-2 protein, BAG domain containing protein.
GCCTGTCCCTGAGTTGTACCCGCTCTATTTTTTTTTTCTCTCTCTTTCTTCTCCATCTCT
CCTCCTTCCTTCCTAACCTCTCCCCACCTACCTCCCTGCCGCCTGATCCTGATTTCCCCA
ATTGAGGCCAGCGTCGAGCACCTGCACACACGCACACGCTCGCTGCTGCGCCTCGATTCT
CGTCCCAGATCCGCCACTCCCTTCCCCAATTCGCCGTCACCTGCAGCTGAGTGTTGCTTG
CTCGAGCTAGCTGGTGGTTCTTGCCTTGCAGGGCGAGGCAGTGGTAGCTTGCGAGCTTTA
GCTGCGGGAGCGGTTGGCTTTGGTTTTGGTTTGGTAAATTGGTTGCGTGTGCGTGTGCGT
GCCATGAGAAGATGATGCGCGCCAAGGCGAAAGGTACATTCCCACCGGCGGCGGCGGCGA
TGAAGGAGAGCTCTGCTCCTCCGCCGCCTGCTGCTGCGGCGGCGGCGGCGAGGGAGGATG
AGTGGGAGGTGCGGCCAGGTGGGATGCTGGTGCAGAAGAGGAGCCCGGACGGCGACGCCC
CGGCCGCGCCCGTGCCCACCATCCGCGTCAAGGTCAAGTTCAACGGCGTCTACCACGAGA
TCTACATCAACTCGCAGGCGTCCTTCGGTGAGCTGAAGAAGCAGCTGTCGGCGCCGACGG
GGCTGCACCCGGAGGACCAGAAGATCGTTTACAAGGACAAGGAGAGGGACTCCAAGGCGT
TCCTCGACATGGCCGGCGTCAAGGACCGCTCCAAGATGGTGCTCCTCGAGGACCCAACGG
CGCAGGCCAAGCGCCTCCTCGAGCAACGCCGCACCGACAAGGCCGAGCGCGCCGCCAAGT
CCATCTCCCGCATCAGCCTCGACGTCGACAAGCTCGCCACCAAGGTGACGGCTCTGGAGG
CCATCGTCGGCAAGGGCGGGAGGGTGGTCGACGCCGACGTGGTCACGCTCACGGAGGCGC
TGATGAACGAGCTGGTCAAGCTGGACGCCATCGCCGCCGAGGGCGAGGTCAAGGTGCAGA
GGCGAATGCAGGAGAAGCGGGTGCAGAAGTACGTGGAGTCGCTGGACGCCATCCGCGCCA
AGAACGCGGCGTCGCACAACAAGGCCAGCGGCAACGGCCACGCCAAGCCCCGGGCGCCGC
ACCTCCCGCCGCCGGTGTCGCAGCGGCGGCAGTTCCAGGCGCCGCCGCCCGCCGCGCCAA
CGACAACGAagaccgccgccgcgccggcgccgccgcccacggcgagctgggagtcgttcg
acctgctgtcctcgatgccgtccacgtcgtcgtccaccgtgacgaccaccatggccgccg
cgacgaccaccaccaccacctcgccgatcccgcggttcgattgggagctcttctagctcg
ctctcgctctccctctcctcCTCCTCCGATGGGTACACTACTCTACACTACACTACACTA
CACACTTCACCTTTTCTTTGTCCATTCATCTCGTGAGCTCATTCGATCGGTCGCACTAGC
ACCTGATCGATCAGCAGCGCTCGCCATTGTTTCTTTGATTTCTTCTGTTCATTCTTCCTC
TTCTTTCTTTTTTCTTCATGTTCCTTTTTTCATTTCGAGAGTATATCTACAAAAACAAAA
AAGAAGAAACACCATGGGTGATCGAGTGTGTTCAGTACGTATGTCATCACTCAAGTCAGT
TCATCAATCCAATGCATGGTCAGTCACACAGCCAAAAAAGAAAAAAGTGGGTGGTATCAT
GACGAAGAATTTTCCGGTGACACTATATATATACAAAAAAAACAGCATGTATATGTGATT
CGAAAC

CDS

1005 bp

>Os09t0524800-02 Apoptosis regulator Bcl-2 protein, BAG domain containing protein.
ATGATGCGCGCCAAGGCGAAAGGTACATTCCCACCGGCGGCGGCGGCGATGAAGGAGAGC
TCTGCTCCTCCGCCGCCTGCTGCTGCGGCGGCGGCGGCGAGGGAGGATGAGTGGGAGGTG
CGGCCAGGTGGGATGCTGGTGCAGAAGAGGAGCCCGGACGGCGACGCCCCGGCCGCGCCC
GTGCCCACCATCCGCGTCAAGGTCAAGTTCAACGGCGTCTACCACGAGATCTACATCAAC
TCGCAGGCGTCCTTCGGTGAGCTGAAGAAGCAGCTGTCGGCGCCGACGGGGCTGCACCCG
GAGGACCAGAAGATCGTTTACAAGGACAAGGAGAGGGACTCCAAGGCGTTCCTCGACATG
GCCGGCGTCAAGGACCGCTCCAAGATGGTGCTCCTCGAGGACCCAACGGCGCAGGCCAAG
CGCCTCCTCGAGCAACGCCGCACCGACAAGGCCGAGCGCGCCGCCAAGTCCATCTCCCGC
ATCAGCCTCGACGTCGACAAGCTCGCCACCAAGGTGACGGCTCTGGAGGCCATCGTCGGC
AAGGGCGGGAGGGTGGTCGACGCCGACGTGGTCACGCTCACGGAGGCGCTGATGAACGAG
CTGGTCAAGCTGGACGCCATCGCCGCCGAGGGCGAGGTCAAGGTGCAGAGGCGAATGCAG
GAGAAGCGGGTGCAGAAGTACGTGGAGTCGCTGGACGCCATCCGCGCCAAGAACGCGGCG
TCGCACAACAAGGCCAGCGGCAACGGCCACGCCAAGCCCCGGGCGCCGCACCTCCCGCCG
CCGGTGTCGCAGCGGCGGCAGTTCCAGGCGCCGCCGCCCGCCGCGCCAACGACAACGAag
accgccgccgcgccggcgccgccgcccacggcgagctgggagtcgttcgacctgctgtcc
tcgatgccgtccacgtcgtcgtccaccgtgacgaccaccatggccgccgcgacgaccacc
accaccacctcgccgatcccgcggttcgattgggagctcttctag

Protein

335 aa

>Os09t0524800-02 Apoptosis regulator Bcl-2 protein, BAG domain containing protein.
MMRAKAKGTFPPAAAAMKESSAPPPPAAAAAAAREDEWEVRPGGMLVQKRSPDGDAPAAP
VPTIRVKVKFNGVYHEIYINSQASFGELKKQLSAPTGLHPEDQKIVYKDKERDSKAFLDM
AGVKDRSKMVLLEDPTAQAKRLLEQRRTDKAERAAKSISRISLDVDKLATKVTALEAIVG
KGGRVVDADVVTLTEALMNELVKLDAIAAEGEVKVQRRMQEKRVQKYVESLDAIRAKNAA
SHNKASGNGHAKPRAPHLPPPVSQRRQFQAPPPAAPTTTKTAAAPAPPPTASWESFDLLS
SMPSTSSSTVTTTMAAATTTTTTSPIPRFDWELF*

5'UTR

chr09:20496268..20496638 (- strand) : 371 bp

CDS

chr09:20496012..20496267 (- strand) : 256 bp

chr09:20495632..20495888 (- strand) : 257 bp

chr09:20495407..20495553 (- strand) : 147 bp

chr09:20494970..20495314 (- strand) : 345 bp

3'UTR

chr09:20494540..20494969 (- strand) : 430 bp

FASTA

>Os09t0524800-02 class=Sequence position=chr09:20494540..20496638 (- strand)
GCCTGTCCCT GAGTTGTACC CGCTCTATTT TTTTTTTCTC TCTCTTTCTT CTCCATCTCT CCTCCTTCCT TCCTAACCTC
TCCCCACCTA CCTCCCTGCC GCCTGATCCT GATTTCCCCA ATTGAGGCCA GCGTCGAGCA CCTGCACACA CGCACACGCT
CGCTGCTGCG CCTCGATTCT CGTCCCAGAT CCGCCACTCC CTTCCCCAAT TCGCCGTCAC CTGCAGCTGA GTGTTGCTTG
CTCGAGCTAG CTGGTGGTTC TTGCCTTGCA GGGCGAGGCA GTGGTAGCTT GCGAGCTTTA GCTGCGGGAG CGGTTGGCTT
TGGTTTTGGT TTGGTAAATT GGTTGCGTGT GCGTGTGCGT GCCATGAGAA GATGATGCGC GCCAAGGCGA AAGGTACATT
CCCACCGGCG GCGGCGGCGA TGAAGGAGAG CTCTGCTCCT CCGCCGCCTG CTGCTGCGGC GGCGGCGGCG AGGGAGGATG
AGTGGGAGGT GCGGCCAGGT GGGATGCTGG TGCAGAAGAG GAGCCCGGAC GGCGACGCCC CGGCCGCGCC CGTGCCCACC
ATCCGCGTCA AGGTCAAGTT CAACGGCGTC TACCACGAGA TCTACATCAA CTCGCAGGCG TCCTTCGGTA ATGCACGCGC
CTCGCCTCGC CGCCGGCGGC GTGCGAGCGC GGCGTCTGGT TTTTTTTTTT TTTTGGGGGA GGGGTGTGAT TCGGTCGAGC
AGGTGCTGAT GGTGGTGGTT GGTGGTGCAG GTGAGCTGAA GAAGCAGCTG TCGGCGCCGA CGGGGCTGCA CCCGGAGGAC
CAGAAGATCG TTTACAAGGA CAAGGAGAGG GACTCCAAGG CGTTCCTCGA CATGGCCGGC GTCAAGGACC GCTCCAAGAT
GGTGCTCCTC GAGGACCCAA CGGCGCAGGC CAAGCGCCTC CTCGAGCAAC GCCGCACCGA CAAGGCCGAG CGCGCCGCCA
AGTCCATCTC CCGCATCAGC CTCGACGTCG ACAAGCTCGC CACCAAGGTA ATCAATCACC ACAATTTGCG GCGGCGCGGC
TTCAATTTGG TTCCGAATTA GCTGAATTGG GCGGTGGTCT TGCAGGTGAC GGCTCTGGAG GCCATCGTCG GCAAGGGCGG
GAGGGTGGTC GACGCCGACG TGGTCACGCT CACGGAGGCG CTGATGAACG AGCTGGTCAA GCTGGACGCC ATCGCCGCCG
AGGGCGAGGT CAAGGTGCAG AGGCGAATGC AGGTTAGCAC ACGAACTCCA AACCGATTCT CGTCGCCGTT TCTTGCCCGA
TTGATTTCCG GCGAGCTCAA TTTCCGACGA ACGTCACGTC GCAGGAGAAG CGGGTGCAGA AGTACGTGGA GTCGCTGGAC
GCCATCCGCG CCAAGAACGC GGCGTCGCAC AACAAGGCCA GCGGCAACGG CCACGCCAAG CCCCGGGCGC CGCACCTCCC
GCCGCCGGTG TCGCAGCGGC GGCAGTTCCA GGCGCCGCCG CCCGCCGCGC CAACGACAAC GAagaccgcc gccgcgccgg
cgccgccgcc cacggcgagc tgggagtcgt tcgacctgct gtcctcgatg ccgtccacgt cgtcgtccac cgtgacgacc
accatggccg ccgcgacgac caccaccacc acctcgccga tcccgcggtt cgattgggag ctcttctagc tcgctctcgc
tctccctctc ctcCTCCTCC GATGGGTACA CTACTCTACA CTACACTACA CTACACACTT CACCTTTTCT TTGTCCATTC
ATCTCGTGAG CTCATTCGAT CGGTCGCACT AGCACCTGAT CGATCAGCAG CGCTCGCCAT TGTTTCTTTG ATTTCTTCTG
TTCATTCTTC CTCTTCTTTC TTTTTTCTTC ATGTTCCTTT TTTCATTTCG AGAGTATATC TACAAAAACA AAAAAGAAGA
AACACCATGG GTGATCGAGT GTGTTCAGTA CGTATGTCAT CACTCAAGTC AGTTCATCAA TCCAATGCAT GGTCAGTCAC
ACAGCCAAAA AAGAAAAAAG TGGGTGGTAT CATGACGAAG AATTTTCCGG TGACACTATA TATATACAAA AAAAACAGCA
TGTATATGTG ATTCGAAAC

Locus: Os09g0524800

Loading...

Locus: Os09g0524800

Loading...