Os09t0526700-01

Locus

Os09g0526700

Description

Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UGE3

CGSNL Gene Name

UDP-GLUCOSE EPIMERASE 3

Oryzabase Gene Symbol Synonym(s)

OsUGE3, OsUGE4

Oryzabase Gene Name Synonym(s)

UDP-glucose epimerase 3

Transcript Evidence

AK073610 (DDBJ, Best hit)

Protein Evidence

A6MD13 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: galactose metabolic process (GO:0006012)

Biological Process: cellular metabolic process (GO:0044237)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD-dependent epimerase/dehydratase (IPR001509)

UDP-glucose 4-epimerase (IPR005886)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J033049I18 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0526700-01)

RiceXPro (AK073610)

Others

Oryzabase (12412)

KEGG (Os09t0526700-01 (EC:5.1.3.2))

Transcript

1424 bp

>Os09t0526700-01 Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).
ACGGTGCGGTTTCCCTTTCCCATATAAATCCCCCCCGCGTCCGCTGCGAACTACTAAACC
GAGAGAGAGAGGCGCACACACGAAGACGAGGCGGCGATGGTGAGCGGCGGAGGAGTAGCG
GCGGAGAACGGCGAGATGGTGGGGAACGGGGAGGGGAGGAAGGGTGCGGGGGCGAGCGTG
CTGGTGACGGGGGGAGCGGGGTACATCGGGACGCACACGGTGCTGCGGCTGCTGGAGAAG
GGGTTCGCGGTCACCGTCGTCGACAACTTCCACAACTCCGTCCCGGAGGCGCTCGACCGC
GTCCGCCTCATCGCCGGCGCCGCCCTCTCCGCCCGCCTCGACTTCATCGCCGGGGATCTC
AAGAGCAAGGACGACATGGAGAAGGTGTTCGCCGCCAAGAGGTATGACGCCGTGATCCAC
TTCGCCGGGCTGAAGGCGGTGGGGGAGAGCGTCGCGCACCCGCAGATGTACTACGAGAAC
AACGTCGCCGGCACCATGAACCTCTACTCCGCCATGACCAAGTACGGCTGCAAGAAGATA
GTGTTCTCGTCGTCGGCGACGGTGTACGGCCAGCCGGAGAAGACCCCCTGCGTCGAGGAT
TCCAAGCTGAGCGCTCTCAACCCATACGGCACCACCAAGCTCGTCCTGGAGAACTACTTC
CGGCAGGTGCAGGCCGCCGACCCGGAGATGAGGGTGATCCTGCTCAGGTACTTCAACCCC
ATCGGCGCTCACCGGAGCGGCGACATCGGGGAGGACCCCAGGGGCATCCCCAACAACCTT
CTTCCGTACATCCAGCAGGTCGCCGTCGGCCGCCGCCCCGAGCTCAACGTCTACGGCGTC
GACTACCCAACCAGGGACGGCACCGCGATCAGGGATTACATACATGTAGTGGACCTTGCC
GATGGCCACATTGCCGCACTGGAGAAGCTCTTCGCTACTCCTGACATTGGTTGTGTGGCT
TACAATCTAGGAACAGGGTGTGGAACAACGGTGCTCGAGGTGGTGAAGGCGTTCGAGGAG
GCGTCCGGAAAGAAAATTCCTATCAAGATTTGCCCCAGAAGACCTGGAGATTGCACTGAG
GTTTACGCTTCCACTGACAAGGCCAAGAAGGAGCTCGGATGGAGTGCTCGGTTTGGAATA
GAGGACATGTGCAGGGACCAGTGGAATTGGGCCAAGAAGAATCCGTACGGATACAGCGCC
AATGCTGAGCAGAATTAGGGCGATCATATTACCACTTATATAGTACTAGTATCAAAATTG
TCCATGGTCTTATGAACTGTGTGACTAGAAAATGTTAATAAGACATGCGTGCCTCTTAAG
TGGAGTATACCAATTCTTATTTAGTCGAATCCGTTGTGATTTTAGATACTGGCAAATGTT
AATCAGGTTTATTTAAATACTATACTAGTAGCAAGATCAAATTG

CDS

1122 bp

>Os09t0526700-01 Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).
ATGGTGAGCGGCGGAGGAGTAGCGGCGGAGAACGGCGAGATGGTGGGGAACGGGGAGGGG
AGGAAGGGTGCGGGGGCGAGCGTGCTGGTGACGGGGGGAGCGGGGTACATCGGGACGCAC
ACGGTGCTGCGGCTGCTGGAGAAGGGGTTCGCGGTCACCGTCGTCGACAACTTCCACAAC
TCCGTCCCGGAGGCGCTCGACCGCGTCCGCCTCATCGCCGGCGCCGCCCTCTCCGCCCGC
CTCGACTTCATCGCCGGGGATCTCAAGAGCAAGGACGACATGGAGAAGGTGTTCGCCGCC
AAGAGGTATGACGCCGTGATCCACTTCGCCGGGCTGAAGGCGGTGGGGGAGAGCGTCGCG
CACCCGCAGATGTACTACGAGAACAACGTCGCCGGCACCATGAACCTCTACTCCGCCATG
ACCAAGTACGGCTGCAAGAAGATAGTGTTCTCGTCGTCGGCGACGGTGTACGGCCAGCCG
GAGAAGACCCCCTGCGTCGAGGATTCCAAGCTGAGCGCTCTCAACCCATACGGCACCACC
AAGCTCGTCCTGGAGAACTACTTCCGGCAGGTGCAGGCCGCCGACCCGGAGATGAGGGTG
ATCCTGCTCAGGTACTTCAACCCCATCGGCGCTCACCGGAGCGGCGACATCGGGGAGGAC
CCCAGGGGCATCCCCAACAACCTTCTTCCGTACATCCAGCAGGTCGCCGTCGGCCGCCGC
CCCGAGCTCAACGTCTACGGCGTCGACTACCCAACCAGGGACGGCACCGCGATCAGGGAT
TACATACATGTAGTGGACCTTGCCGATGGCCACATTGCCGCACTGGAGAAGCTCTTCGCT
ACTCCTGACATTGGTTGTGTGGCTTACAATCTAGGAACAGGGTGTGGAACAACGGTGCTC
GAGGTGGTGAAGGCGTTCGAGGAGGCGTCCGGAAAGAAAATTCCTATCAAGATTTGCCCC
AGAAGACCTGGAGATTGCACTGAGGTTTACGCTTCCACTGACAAGGCCAAGAAGGAGCTC
GGATGGAGTGCTCGGTTTGGAATAGAGGACATGTGCAGGGACCAGTGGAATTGGGCCAAG
AAGAATCCGTACGGATACAGCGCCAATGCTGAGCAGAATTAG

Protein

374 aa

>Os09t0526700-01 Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).
MVSGGGVAAENGEMVGNGEGRKGAGASVLVTGGAGYIGTHTVLRLLEKGFAVTVVDNFHN
SVPEALDRVRLIAGAALSARLDFIAGDLKSKDDMEKVFAAKRYDAVIHFAGLKAVGESVA
HPQMYYENNVAGTMNLYSAMTKYGCKKIVFSSSATVYGQPEKTPCVEDSKLSALNPYGTT
KLVLENYFRQVQAADPEMRVILLRYFNPIGAHRSGDIGEDPRGIPNNLLPYIQQVAVGRR
PELNVYGVDYPTRDGTAIRDYIHVVDLADGHIAALEKLFATPDIGCVAYNLGTGCGTTVL
EVVKAFEEASGKKIPIKICPRRPGDCTEVYASTDKAKKELGWSARFGIEDMCRDQWNWAK
KNPYGYSANAEQN*

5'UTR

chr09:20602908..20603003 (- strand) : 96 bp

CDS

chr09:20602653..20602907 (- strand) : 255 bp

chr09:20602498..20602547 (- strand) : 50 bp

chr09:20602227..20602362 (- strand) : 136 bp

chr09:20602039..20602140 (- strand) : 102 bp

chr09:20601628..20601855 (- strand) : 228 bp

chr09:20601459..20601540 (- strand) : 82 bp

chr09:20601266..20601348 (- strand) : 83 bp

chr09:20601059..20601150 (- strand) : 92 bp

chr09:20600828..20600921 (- strand) : 94 bp

3'UTR

chr09:20600622..20600827 (- strand) : 206 bp

FASTA

>Os09t0526700-01 class=Sequence position=chr09:20600622..20603003 (- strand)
ACGGTGCGGT TTCCCTTTCC CATATAAATC CCCCCCGCGT CCGCTGCGAA CTACTAAACC GAGAGAGAGA GGCGCACACA
CGAAGACGAG GCGGCGATGG TGAGCGGCGG AGGAGTAGCG GCGGAGAACG GCGAGATGGT GGGGAACGGG GAGGGGAGGA
AGGGTGCGGG GGCGAGCGTG CTGGTGACGG GGGGAGCGGG GTACATCGGG ACGCACACGG TGCTGCGGCT GCTGGAGAAG
GGGTTCGCGG TCACCGTCGT CGACAACTTC CACAACTCCG TCCCGGAGGC GCTCGACCGC GTCCGCCTCA TCGCCGGCGC
CGCCCTCTCC GCCCGCCTCG ACTTCATCGC CGTACGTGAC TCACCCAAAC AGCACGCGTG TTCTTCGTCT TGCACAGTTG
AATTGAACCG AGCCGGCGAG GTTGAGATTG AGATTCATGT TTGTGTTCGT TTTCAGGGGG ATCTCAAGAG CAAGGACGAC
ATGGAGAAGG TGTTCGCCGC CAAGAGGTCC GGATTGGATC GTTTTGCTTC GATCAAACAA GCCATCTAAC TCAAATCCTT
TTTGATTTTG ATCTCAACTC GTTCGTTTCC ACACGTAATC AAACGCGTCG TCGTCGTCGT CGTCGTCCAT TGATCGATCA
GGTATGACGC CGTGATCCAC TTCGCCGGGC TGAAGGCGGT GGGGGAGAGC GTCGCGCACC CGCAGATGTA CTACGAGAAC
AACGTCGCCG GCACCATGAA CCTCTACTCC GCCATGACCA AGTACGGCTG CAAGAAGGTC AGTACTATAC ATCTACACGA
TCACCTGATT GATTCCATTC CGATGCATGC TTCGATCACT GAAATCAACA AACCTACGCG CAGATAGTGT TCTCGTCGTC
GGCGACGGTG TACGGCCAGC CGGAGAAGAC CCCCTGCGTC GAGGATTCCA AGCTGAGCGC TCTCAACCCA TACGGCACCA
CCAAGGTATA AGACATGATC GCATCCATTG CTCGTGATAA GCATGCACCC GTCACGCGCC ATTCGGATTC GCTTCGCCGA
TTCGGTGATT ACGATGCCGA ATTGCGATGG CGATGATCAC ACCATTGCTT TTTTGCTATG CAAGCATTGT TTCTAACGGC
ATCGAATTCG ATTCTCTCGT TGGGGCAGCT CGTCCTGGAG AACTACTTCC GGCAGGTGCA GGCCGCCGAC CCGGAGATGA
GGGTGATCCT GCTCAGGTAC TTCAACCCCA TCGGCGCTCA CCGGAGCGGC GACATCGGGG AGGACCCCAG GGGCATCCCC
AACAACCTTC TTCCGTACAT CCAGCAGGTC GCCGTCGGCC GCCGCCCCGA GCTCAACGTC TACGGCGTCG ACTACCCAAC
CAGGGACGGC ACCGCGGTGA GCACTACACT GTTCAAGATC AATTTGTATG GATGAGATCG TGGAGCGAAG CAAAATTTTG
ACAATTTGAT ATATCGTCCT CAGATCAGGG ATTACATACA TGTAGTGGAC CTTGCCGATG GCCACATTGC CGCACTGGAG
AAGCTCTTCG CTACTCCTGA CATTGGTACA TCAATCGATG CTACAAACAC ACATGTTCTT CACTCCATAA ACTGGTTGAT
GTTTGACAAG TTTAATTCAT CCATGATGTA TAATTTCTTT ATTTTCTTCT GTCAGGTTGT GTGGCTTACA ATCTAGGAAC
AGGGTGTGGA ACAACGGTGC TCGAGGTGGT GAAGGCGTTC GAGGAGGCGT CCGGAAAGGT GACTGATGTA GTATTATTTA
TGCATCCATG TGTGCATGGT TGATATTCGC CTCATCTGAA ATCCCAATCT GAAAATGTGG TCGAAACTGA CGTTTCTGGC
TGTGAAACCA CAGAAAATTC CTATCAAGAT TTGCCCCAGA AGACCTGGAG ATTGCACTGA GGTTTACGCT TCCACTGACA
AGGCCAAGAA GGAGCTCGGA TGGAGGTAAT TTATTCTCTG ATTCGCTACA GAACGATCAC ACAAATCTGT CTGTCCATTT
TTCCAGCTCA CTGTTCAACT GACAGTTATA GTTTGTGCTT ATGATAGAGA TGCTGATTGT TTTATGCTTG TGCTGATTGC
AGTGCTCGGT TTGGAATAGA GGACATGTGC AGGGACCAGT GGAATTGGGC CAAGAAGAAT CCGTACGGAT ACAGCGCCAA
TGCTGAGCAG AATTAGGGCG ATCATATTAC CACTTATATA GTACTAGTAT CAAAATTGTC CATGGTCTTA TGAACTGTGT
GACTAGAAAA TGTTAATAAG ACATGCGTGC CTCTTAAGTG GAGTATACCA ATTCTTATTT AGTCGAATCC GTTGTGATTT
TAGATACTGG CAAATGTTAA TCAGGTTTAT TTAAATACTA TACTAGTAGC AAGATCAAAT TG

Locus: Os09g0526700

Loading...

Locus: Os09g0526700

Loading...