Os09t0526700-02

Locus

Os09g0526700

Description

Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UGE3

CGSNL Gene Name

UDP-GLUCOSE EPIMERASE 3

Oryzabase Gene Symbol Synonym(s)

OsUGE3, OsUGE4

Oryzabase Gene Name Synonym(s)

UDP-glucose epimerase 3

Transcript Evidence

AK104977 (DDBJ, Best hit)

Protein Evidence

A6MD13 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: galactose metabolic process (GO:0006012)

Biological Process: cellular metabolic process (GO:0044237)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD-dependent epimerase/dehydratase (IPR001509)

UDP-glucose 4-epimerase (IPR005886)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

001-124-A06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0526700-02)

Others

Oryzabase (12412)

Transcript

1375 bp

>Os09t0526700-02 Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).
AAACCGAGAGAGAGAGGCGCACACACGAAGACGAGGCGGCGATGGTGAGCGGCGGAGGAG
TAGCGGCGGAGAACGGCGAGATGGTGGGGAACGGGGAGGGGAGGAAGGGTGCGGGGGCGA
GCGTGCTGGTGACGGGGGGAGCGGGGTACATCGGGACGCACACGGTGCTGCGGCTGCTGG
AGAAGGGGTTCGCGGTCACCGTCGTCGACAACTTCCACAACTCCGTCCCGGAGGCGCTCG
ACCGCGTCCGCCTCATCGCCGGCGCCGCCCTCTCCGCCCGCCTCGACTTCATCGCCGGGG
ATCTCAAGAGCAAGGACGACATGGAGAAGGTGTTCGCCGCCAAGAGGTATGACGCCGTGA
TCCACTTCGCCGGGCTGAAGGCGGTGGGGGAGAGCGTCGCGCACCCGCAGATGTACTACG
AGAACAACGTCGCCGGCACCATGAACCTCTACTCCGCCATGACCAAGTACGGCTGCAAGA
AGATAGTGTTCTCGTCGTCGGCGACGGTGTACGGCCAGCCGGAGAAGACCCCCTGCGTCG
AGGATTCCAAGCTGAGCGCTCTCAACCCATACGGCACCACCAAGCTCGTCCTGGAGAACT
ACTTCCGGCAGGTGCAGGCCGCCGACCCGGAGATGAGGGTGATCCTGCTCAGGTACTTCA
ACCCCATCGGCGCTCACCGGAGCGGCGACATCGGGGAGGACCCCAGGGGCATCCCCAACA
ACCTTCTTCCGTACATCCAGCAGGTCGCCGTCGGCCGCCGCCCCGAGCTCAACGTCTACG
GCGTCGACTACCCAACCAGGGACGGCACCGCGATCAGGGATTACATACATGTAGTGGACC
TTGCCGATGGCCACATTGCCGCACTGGAGAAGCTCTTCGCTACTCCTGACATTGGTTGTG
TGGCTTACAATCTAGGAACAGGGTGTGGAACAACGGTGCTCGAGGTGGTGAAGGCGTTCG
AGGAGGCGTCCGGAAAGAAAATTCCTATCAAGATTTGCCCCAGAAGACCTGGAGATTGCA
CTGAGGTTTACGCTTCCACTGACAAGGCCAAGAAGGAGCTCGGATGGAGTGCTCGGTTTG
GAATAGAGGACATGTGCAGGGACCAGTGGAATTGGGCCAAGAAGAATCCGTACGGATACA
GCGCCAATGCTGAGCAGAATTAGGGCGATCATATTACCACTTATATAGTACTAGTATCAA
AATTGTCCATGGTCTTATGAACTGTGTGACTAGAAAATGTTAATAAGACATGCGTGCCTC
TTAAGTGGAGTATACCAATTCTTATTTAGTCGAATCCGTTGTGATTTTAGATACTGGCAA
ATGTTAATCAGGTTTATTTAAATACTATACTAGTAGCAAGATCAAATTGAACAAT

CDS

1122 bp

>Os09t0526700-02 Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).
ATGGTGAGCGGCGGAGGAGTAGCGGCGGAGAACGGCGAGATGGTGGGGAACGGGGAGGGG
AGGAAGGGTGCGGGGGCGAGCGTGCTGGTGACGGGGGGAGCGGGGTACATCGGGACGCAC
ACGGTGCTGCGGCTGCTGGAGAAGGGGTTCGCGGTCACCGTCGTCGACAACTTCCACAAC
TCCGTCCCGGAGGCGCTCGACCGCGTCCGCCTCATCGCCGGCGCCGCCCTCTCCGCCCGC
CTCGACTTCATCGCCGGGGATCTCAAGAGCAAGGACGACATGGAGAAGGTGTTCGCCGCC
AAGAGGTATGACGCCGTGATCCACTTCGCCGGGCTGAAGGCGGTGGGGGAGAGCGTCGCG
CACCCGCAGATGTACTACGAGAACAACGTCGCCGGCACCATGAACCTCTACTCCGCCATG
ACCAAGTACGGCTGCAAGAAGATAGTGTTCTCGTCGTCGGCGACGGTGTACGGCCAGCCG
GAGAAGACCCCCTGCGTCGAGGATTCCAAGCTGAGCGCTCTCAACCCATACGGCACCACC
AAGCTCGTCCTGGAGAACTACTTCCGGCAGGTGCAGGCCGCCGACCCGGAGATGAGGGTG
ATCCTGCTCAGGTACTTCAACCCCATCGGCGCTCACCGGAGCGGCGACATCGGGGAGGAC
CCCAGGGGCATCCCCAACAACCTTCTTCCGTACATCCAGCAGGTCGCCGTCGGCCGCCGC
CCCGAGCTCAACGTCTACGGCGTCGACTACCCAACCAGGGACGGCACCGCGATCAGGGAT
TACATACATGTAGTGGACCTTGCCGATGGCCACATTGCCGCACTGGAGAAGCTCTTCGCT
ACTCCTGACATTGGTTGTGTGGCTTACAATCTAGGAACAGGGTGTGGAACAACGGTGCTC
GAGGTGGTGAAGGCGTTCGAGGAGGCGTCCGGAAAGAAAATTCCTATCAAGATTTGCCCC
AGAAGACCTGGAGATTGCACTGAGGTTTACGCTTCCACTGACAAGGCCAAGAAGGAGCTC
GGATGGAGTGCTCGGTTTGGAATAGAGGACATGTGCAGGGACCAGTGGAATTGGGCCAAG
AAGAATCCGTACGGATACAGCGCCAATGCTGAGCAGAATTAG

Protein

374 aa

>Os09t0526700-02 Similar to UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase).
MVSGGGVAAENGEMVGNGEGRKGAGASVLVTGGAGYIGTHTVLRLLEKGFAVTVVDNFHN
SVPEALDRVRLIAGAALSARLDFIAGDLKSKDDMEKVFAAKRYDAVIHFAGLKAVGESVA
HPQMYYENNVAGTMNLYSAMTKYGCKKIVFSSSATVYGQPEKTPCVEDSKLSALNPYGTT
KLVLENYFRQVQAADPEMRVILLRYFNPIGAHRSGDIGEDPRGIPNNLLPYIQQVAVGRR
PELNVYGVDYPTRDGTAIRDYIHVVDLADGHIAALEKLFATPDIGCVAYNLGTGCGTTVL
EVVKAFEEASGKKIPIKICPRRPGDCTEVYASTDKAKKELGWSARFGIEDMCRDQWNWAK
KNPYGYSANAEQN*

5'UTR

chr09:20602908..20602948 (- strand) : 41 bp

CDS

chr09:20602653..20602907 (- strand) : 255 bp

chr09:20602498..20602547 (- strand) : 50 bp

chr09:20602227..20602362 (- strand) : 136 bp

chr09:20602039..20602140 (- strand) : 102 bp

chr09:20601628..20601855 (- strand) : 228 bp

chr09:20601459..20601540 (- strand) : 82 bp

chr09:20601266..20601348 (- strand) : 83 bp

chr09:20601059..20601150 (- strand) : 92 bp

chr09:20600828..20600921 (- strand) : 94 bp

3'UTR

chr09:20600616..20600827 (- strand) : 212 bp

FASTA

>Os09t0526700-02 class=Sequence position=chr09:20600616..20602948 (- strand)
AAACCGAGAG AGAGAGGCGC ACACACGAAG ACGAGGCGGC GATGGTGAGC GGCGGAGGAG TAGCGGCGGA GAACGGCGAG
ATGGTGGGGA ACGGGGAGGG GAGGAAGGGT GCGGGGGCGA GCGTGCTGGT GACGGGGGGA GCGGGGTACA TCGGGACGCA
CACGGTGCTG CGGCTGCTGG AGAAGGGGTT CGCGGTCACC GTCGTCGACA ACTTCCACAA CTCCGTCCCG GAGGCGCTCG
ACCGCGTCCG CCTCATCGCC GGCGCCGCCC TCTCCGCCCG CCTCGACTTC ATCGCCGTAC GTGACTCACC CAAACAGCAC
GCGTGTTCTT CGTCTTGCAC AGTTGAATTG AACCGAGCCG GCGAGGTTGA GATTGAGATT CATGTTTGTG TTCGTTTTCA
GGGGGATCTC AAGAGCAAGG ACGACATGGA GAAGGTGTTC GCCGCCAAGA GGTCCGGATT GGATCGTTTT GCTTCGATCA
AACAAGCCAT CTAACTCAAA TCCTTTTTGA TTTTGATCTC AACTCGTTCG TTTCCACACG TAATCAAACG CGTCGTCGTC
GTCGTCGTCG TCCATTGATC GATCAGGTAT GACGCCGTGA TCCACTTCGC CGGGCTGAAG GCGGTGGGGG AGAGCGTCGC
GCACCCGCAG ATGTACTACG AGAACAACGT CGCCGGCACC ATGAACCTCT ACTCCGCCAT GACCAAGTAC GGCTGCAAGA
AGGTCAGTAC TATACATCTA CACGATCACC TGATTGATTC CATTCCGATG CATGCTTCGA TCACTGAAAT CAACAAACCT
ACGCGCAGAT AGTGTTCTCG TCGTCGGCGA CGGTGTACGG CCAGCCGGAG AAGACCCCCT GCGTCGAGGA TTCCAAGCTG
AGCGCTCTCA ACCCATACGG CACCACCAAG GTATAAGACA TGATCGCATC CATTGCTCGT GATAAGCATG CACCCGTCAC
GCGCCATTCG GATTCGCTTC GCCGATTCGG TGATTACGAT GCCGAATTGC GATGGCGATG ATCACACCAT TGCTTTTTTG
CTATGCAAGC ATTGTTTCTA ACGGCATCGA ATTCGATTCT CTCGTTGGGG CAGCTCGTCC TGGAGAACTA CTTCCGGCAG
GTGCAGGCCG CCGACCCGGA GATGAGGGTG ATCCTGCTCA GGTACTTCAA CCCCATCGGC GCTCACCGGA GCGGCGACAT
CGGGGAGGAC CCCAGGGGCA TCCCCAACAA CCTTCTTCCG TACATCCAGC AGGTCGCCGT CGGCCGCCGC CCCGAGCTCA
ACGTCTACGG CGTCGACTAC CCAACCAGGG ACGGCACCGC GGTGAGCACT ACACTGTTCA AGATCAATTT GTATGGATGA
GATCGTGGAG CGAAGCAAAA TTTTGACAAT TTGATATATC GTCCTCAGAT CAGGGATTAC ATACATGTAG TGGACCTTGC
CGATGGCCAC ATTGCCGCAC TGGAGAAGCT CTTCGCTACT CCTGACATTG GTACATCAAT CGATGCTACA AACACACATG
TTCTTCACTC CATAAACTGG TTGATGTTTG ACAAGTTTAA TTCATCCATG ATGTATAATT TCTTTATTTT CTTCTGTCAG
GTTGTGTGGC TTACAATCTA GGAACAGGGT GTGGAACAAC GGTGCTCGAG GTGGTGAAGG CGTTCGAGGA GGCGTCCGGA
AAGGTGACTG ATGTAGTATT ATTTATGCAT CCATGTGTGC ATGGTTGATA TTCGCCTCAT CTGAAATCCC AATCTGAAAA
TGTGGTCGAA ACTGACGTTT CTGGCTGTGA AACCACAGAA AATTCCTATC AAGATTTGCC CCAGAAGACC TGGAGATTGC
ACTGAGGTTT ACGCTTCCAC TGACAAGGCC AAGAAGGAGC TCGGATGGAG GTAATTTATT CTCTGATTCG CTACAGAACG
ATCACACAAA TCTGTCTGTC CATTTTTCCA GCTCACTGTT CAACTGACAG TTATAGTTTG TGCTTATGAT AGAGATGCTG
ATTGTTTTAT GCTTGTGCTG ATTGCAGTGC TCGGTTTGGA ATAGAGGACA TGTGCAGGGA CCAGTGGAAT TGGGCCAAGA
AGAATCCGTA CGGATACAGC GCCAATGCTG AGCAGAATTA GGGCGATCAT ATTACCACTT ATATAGTACT AGTATCAAAA
TTGTCCATGG TCTTATGAAC TGTGTGACTA GAAAATGTTA ATAAGACATG CGTGCCTCTT AAGTGGAGTA TACCAATTCT
TATTTAGTCG AATCCGTTGT GATTTTAGAT ACTGGCAAAT GTTAATCAGG TTTATTTAAA TACTATACTA GTAGCAAGAT
CAAATTGAAC AAT

Locus: Os09g0526700

Loading...

Locus: Os09g0526700

Loading...