Os09t0527700-01

Locus

Os09g0527700

Description

Similar to Auxin-induced protein IAA4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA26

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA26

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 26

Transcript Evidence

AK111128 (DDBJ, Best hit)

Protein Evidence

Q652A1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

002-176-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0527700-01)

RiceXPro (AK111128)

Others

Oryzabase (10913)

KEGG (Os09t0527700-01)

Transcript

956 bp

>Os09t0527700-01 Similar to Auxin-induced protein IAA4.
ACAGCTCGCCACCATCAGCGTCTTCTTCGTCGAGGTCAGCGGCGGCGACACGGTGTTGGG
TCATGGCGAGCTACGGCGACGACGGCGTGGAGCTCACCGAGCTGACGCTGGGGCCTCCCG
GAGCCAGCGCTCGCAGGGCCAGGCGCGGCAGGAAGAACGGCCATCCGCCGCCGTCGTCCT
CGATGATTCAGGCAGCGTACTTCGTGAAGGTGAGCATGGACGGGACGCCGTACCTGAGGA
AGGTGGACGTCGCGGCGTACGGCGACTACCTCGAGCTCGTCGAGGCGCTCAACGACATGT
TCTACTGCTCCACCATTGGACTGATGGACGGGTACGGCGAGTGGGAGCACGCCGTCGTGT
ACGAGGACGGCGACGGCGACTGGATGCTCGTCGGCGACGTGCCCTGGGAGATGTTCGTGT
CTTCGTGTAAGAGGATGAGAGTGATGCGAGCTTGTGAGGCGAGAGGCTTGAGCTCAAACG
CGTGACAGAAACAATTGCAGGTTGACCAGTGCGTTGTAGATAACTGAACCTGGACATCGA
TCGCTCATGCAAGTGGTGAAAGCGCTGACGAAAAGGATGACGCAATTTTCTGACCGACCA
AAGCTATGCTGCGCACACATGATTGATGCAACAACATCTACAGAAAGACCAGCATATCAG
CATCTCACTAGCTAGCCTGGAATAAATGTTAGTTAAGTAGTTGACACTGCAGATGCGGTC
AATCTCTCCAGCTTGCTGCTTGCTTCTCACATGAGCCTGAATGCCTCTGATACGGTTGAC
TTCCCTGATGAGATCCCAACATTTTAGCTCCCTTTTGCCTCTAGCTAGTTGTAAGTTGTT
TCGGCTGTATATGTATGTATGTCGCATCACATGTACATGGATCAAGAGTTGTTCGTTGTA
CCTCCCAAATTTTGATACAGCTAGCACGAAGATCTTTTGAGTCTGAGATGAGGTTC

CDS

423 bp

>Os09t0527700-01 Similar to Auxin-induced protein IAA4.
ATGGCGAGCTACGGCGACGACGGCGTGGAGCTCACCGAGCTGACGCTGGGGCCTCCCGGA
GCCAGCGCTCGCAGGGCCAGGCGCGGCAGGAAGAACGGCCATCCGCCGCCGTCGTCCTCG
ATGATTCAGGCAGCGTACTTCGTGAAGGTGAGCATGGACGGGACGCCGTACCTGAGGAAG
GTGGACGTCGCGGCGTACGGCGACTACCTCGAGCTCGTCGAGGCGCTCAACGACATGTTC
TACTGCTCCACCATTGGACTGATGGACGGGTACGGCGAGTGGGAGCACGCCGTCGTGTAC
GAGGACGGCGACGGCGACTGGATGCTCGTCGGCGACGTGCCCTGGGAGATGTTCGTGTCT
TCGTGTAAGAGGATGAGAGTGATGCGAGCTTGTGAGGCGAGAGGCTTGAGCTCAAACGCG
TGA

Protein

141 aa

>Os09t0527700-01 Similar to Auxin-induced protein IAA4.
MASYGDDGVELTELTLGPPGASARRARRGRKNGHPPPSSSMIQAAYFVKVSMDGTPYLRK
VDVAAYGDYLELVEALNDMFYCSTIGLMDGYGEWEHAVVYEDGDGDWMLVGDVPWEMFVS
SCKRMRVMRACEARGLSSNA*

5'UTR

chr09:20643078..20643139 (- strand) : 62 bp

CDS

chr09:20642956..20643077 (- strand) : 122 bp

chr09:20642729..20642862 (- strand) : 134 bp

chr09:20642538..20642628 (- strand) : 91 bp

chr09:20642318..20642393 (- strand) : 76 bp

3'UTR

chr09:20642303..20642317 (- strand) : 15 bp

chr09:20641465..20641920 (- strand) : 456 bp

FASTA

>Os09t0527700-01 class=Sequence position=chr09:20641465..20643139 (- strand)
ACAGCTCGCC ACCATCAGCG TCTTCTTCGT CGAGGTCAGC GGCGGCGACA CGGTGTTGGG TCATGGCGAG CTACGGCGAC
GACGGCGTGG AGCTCACCGA GCTGACGCTG GGGCCTCCCG GAGCCAGCGC TCGCAGGGCC AGGCGCGGCA GGAAGAACGG
CCATCCGCCG CCGTCGTCCT CGATGTAATT TCTAGTGTTC TTACACGGCT AATGGTTTTG TGATGATCGA TCAATGTCGC
GTCTCCTCTG ATGGATGGGT TTCGTTGTTC GGTTTAGGAT TCAGGCAGCG TACTTCGTGA AGGTGAGCAT GGACGGGACG
CCGTACCTGA GGAAGGTGGA CGTCGCGGCG TACGGCGACT ACCTCGAGCT CGTCGAGGCG CTCAACGACA TGTTCTACTG
CTCCACCATT GGTGAGCTGC TAGTTTCACC TCGCTGTATA TGCAAGAGTA ATCTGCCAAA CATTGATCAG TAATGGCGGT
TAATAATGTT TTGTGTACGG TGATCGAGCA GGACTGATGG ACGGGTACGG CGAGTGGGAG CACGCCGTCG TGTACGAGGA
CGGCGACGGC GACTGGATGC TCGTCGGCGA CGTGCCCTGG GAGTAAGCAC CGCTGAAACC GCATCGCTTT TTTTATACAT
TACTGAAACT GCGTCATTGC ACTGTTCATC ATCGTTTCAA AATTATGCGA ATGCAAAAAC TAAAGGTAAA CGTGGAAATC
TCAACCTGAT GCATCTTGAA TTGCAGGATG TTCGTGTCTT CGTGTAAGAG GATGAGAGTG ATGCGAGCTT GTGAGGCGAG
AGGCTTGAGC TCAAACGCGT GACAGAAACA ATTGCAGGTG AGGAGGATTA ACTCCAATTC GATCAGATTG GTAAATACAG
AATAGTGCAT GCAGTAGCAT AGTTTCCTTT GTCTGGAAAA AAAAATCTGC AATATGATCA AACTAATCCA TATAGAGAAC
CAATTAAGAA CAACCGAGTA ATCGCACTAA GTTCACTAAC CACTAACTGA TCAGACTGAA ACTTTGACTT CTTGAGTTCT
TTCTCACTGC CAAGAGTTTC AGACTTTCAG TCCATTTCTT TACTAGGGAT GAATATACAA TTGATTCAGG GTTTGGCATT
GTTCAGTTCT TTTCCACTGA TAAACTGATT TAGAGTTTTC GTTGTTAATT CAGTTCTTTT ATACTGCAAT AAACTGATTT
GGATTTTGCG TGGTTCCAGG TTGACCAGTG CGTTGTAGAT AACTGAACCT GGACATCGAT CGCTCATGCA AGTGGTGAAA
GCGCTGACGA AAAGGATGAC GCAATTTTCT GACCGACCAA AGCTATGCTG CGCACACATG ATTGATGCAA CAACATCTAC
AGAAAGACCA GCATATCAGC ATCTCACTAG CTAGCCTGGA ATAAATGTTA GTTAAGTAGT TGACACTGCA GATGCGGTCA
ATCTCTCCAG CTTGCTGCTT GCTTCTCACA TGAGCCTGAA TGCCTCTGAT ACGGTTGACT TCCCTGATGA GATCCCAACA
TTTTAGCTCC CTTTTGCCTC TAGCTAGTTG TAAGTTGTTT CGGCTGTATA TGTATGTATG TCGCATCACA TGTACATGGA
TCAAGAGTTG TTCGTTGTAC CTCCCAAATT TTGATACAGC TAGCACGAAG ATCTTTTGAG TCTGAGATGA GGTTC

Locus: Os09g0527700

Loading...

Locus: Os09g0527700

Loading...