Os09t0529300-01

Locus

Os09g0529300

Description

Similar to Leaf angle-associated protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SPK

CGSNL Gene Name

SPREADING STUB

Oryzabase Gene Symbol Synonym(s)

Spk(t), Spk(t)*), Spk, OsTAC1, TAC1, qTAC9

Oryzabase Gene Name Synonym(s)

Spreading stub, Tiller angle control 1

Transcript Evidence

AK066042 (DDBJ, Best hit)

Protein Evidence

C4IZI7 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013048L17 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0529300-01)

RiceXPro (AK066042)

Others

Oryzabase (862)

KEGG (Os09t0529300-01)

Transcript

2969 bp

>Os09t0529300-01 Similar to Leaf angle-associated protein.
TACTGTCTGGCTTTCTCTTCTGGTTTCATATTGGTTCTAGAGAGATGGCTCTAAAGGTGT
TCAATTGGCTGAATCGGAAGAAGCATTCTAATGTCGAGTATTGCACCATCAATGAGAACA
AGGGTAAGGATACCAGGATATCTCTCTTTTATGTACCACATGTTTTGTTGTTCTCATGTT
GTCAACTCTTGTTTCTTCTCTTCTATTTTTTTTCCTGATGGAGTAGCCATGGAAGAGAAG
GAAGACTCTCTGCGTGCAAGTGTGACTGAGCAAGACACTGAGGCCCTGCTGCTCCGTGAT
GTGCTTATTAATGGTATACTTGCAATTGGCACGCTGGGCCACAATGTAAACTCACTCTGT
CCTGAGTCCTGTATTGAACAAGATGAGCCCATCATCATGTGTGATGAGAAAGTGGAACAA
GAGAAGTGCGAAGAAGAAAAGGCTGAGGCTAAACAGGACACACCAGTTACAGCACCAAGT
GAACCGGCATCTGCTCTTGAGCCTGCCAAGATGCACTCATCATCGATGAAAGAAGACAAC
TTCATGTGCTTTGTGAAGGAGGAAATCCTAATGCATGGCATGGAAGTGGAAGATGTTCCT
AACATCCAGGAACGACCACTTCTGATGTTAGAGAAGGTGGAGAAAGTGAGAACTACACTT
GCCGATCTATTTGCTGCAGAAGCATTCTCATCAAGTGATGCAGAGGATAAGTGTTACCCG
AAAATCGTCATTGTTGCTGGGGCATCCACTTCAAAGCCTACGTCGTGCATGGAGAAGATG
CATCACAAGAAGCCAACAAAACCAACGTCAAAGCCGCTGAAGGCTACAAGAAAATTAAGT
CGAGTATGGTTTTCTTCGTCTCTGCTTTATTTGTTAAGCCTTGTTACATTATATTTTACT
AGTCTGGAATTTATTACACTTTGTTCCATGGTCAGTGCGCCACATCTTACACATATGTTT
TACCATATAGCTACAACTGGAGTAAGCATTATGCATCTAGCCAGTCTTTAGTGGTAAATG
ATCACTGACCTGGAATGCACCTTTTTGGTTTTTGTCATCTGTAAAATAAGTAGGTCATGA
GGAAGATGTTGGGGAAGAAGATCCACCCAGAGCAGCTCAATGGACGTAGCAATGCAGAGG
GCCCTGTCACTGCATAATGCTAGGTTTGTGGACAAAAGTTTCCTTTCTCTATCTGGCAAT
TTATTACCTAGAGTTTTTTTAAAGCTGTCTGTTGAACTATACAGGGCTCAAGGCCCTTGT
GTTTTGCATACGATTTTGTACCTTTCCAAATTTTCTTGATTTTTACTTGGATTCCATTGT
TTGTAATAAAATTAGGTTAATATCTGAGGTAGTATTTGCATAGAATGGATACCTTCTACC
AAAGTTATATTTGTTTGTGGGTCCTAGAGCTAGCATGACCCACGAATCACATTCAAGAAT
ATAGTAATTCGTTTAGGCTACATTTCACTAGGAATAGAACATATGAATATTCTCAGGTTT
AATAAGGCAGATGCAAAAAAGAACTGAATAGCACAGGAAAGTAATTTTTCCATTTCAAGC
TTCTCACAGTCAAAAACAAGTAATGGTTCAAAAATTGAATATTCTATCACCTGTTGCCTC
CATTTATGTGGAACTCACAAGAGGGTCTAAGTGCTGCTTGACACTCTGACCTGTATTTAA
ATAAAATGTTATCACCTATTGCCTCTGCTTATTATTGGGATCTCAAAACACAATCTATTA
CTGTGTATGCCTTGGCATTTTTTAAAATCTGAGCTGCCCCCTTATTCTTCACATTTTCTC
AGAAAACCATATAAACttttagataaatgaagcttttattgatctcagacaattacatca
agttgatagaaccaaactaagaacacttctggcctctgataaTGGAACTGCTGTTTGTTT
AAGTAGAAAGAATGGTGTGTGTATTTTAACGGTTGGTGATTGGGAATTGGGATGCAGTGA
CCATGGAGACTGTGTTCTTCAGAATATTTTTAAGAAATAGTGTTTTCGGTGGATCCTATC
ATGGAACTGCCTATGGTGGAAAGAGCAATACGAGTTGAAACATATAGGGATTAGGAAGCA
TGGGTTCGGACTAAAATGCATTCGTTCCTGCCATGATGCAAAGCTTCATTCGAAGCAAAA
TGAGCACATGCCATGGTACAGTGGCGTGCAACGAGCACTGCAATTGCACACGACGTGCAT
GTTCTGAAAAAGGCCAGTGGACACTAGACATGCAGCTAATCCTCTTTTGATGAATTCTAT
CATGAAACCAATGGATTCGTTGAAAATCTGAACAAATTGATGGATTTGGTCCCAGCTGTA
GAAAGGTTGGCAAACTCTTCTCGCTCCTGTATTATTGTAGGCTGGAGCTATGATGGACCA
AATCATCAGAAGCAAATTTCACCATATATAAGCATCTACTTTTATCTTTTTCTCTATTTT
AAAATGTGATCATAGTGAAGTTATATACATTCTATCTGCTTAACGCTCCACATTATCCAA
AAAAATGCATCACACTCCATATTGGGAACACGTTGGTGGTTCTGAACCAAAGTCGATCTC
TTGATGCCAATTTTTTTTTTGAGCTGGTTGAGTAGTCGAACTGGGAACAATTACTGCTTG
AGGCTACAAAATTTCTGGCCGACAATACGTCTTGATCAGGAACTGACTAAAGAAATTCCC
TTTCACCTTTTGCGGGATTTGTTGGATCCATCCTCACGCTTCGGATTCCTTGCTCAAGAG
AAACATCCATGCATATCGTCGACAGCGTTCGTTCAGTCCTCTTCCTTTTGTTGTTGGTGC
TGTTGTTATTATTGTTATTGTTATTGCTGCCTATTCGCTCGCCAGTGATGAAGAATAGTC
CTGCCTATATTTGCCTGTAGTACATTGTAAAGCTACAGTTGACGTGTCTTGTAAGACCCT
TATTATTATTGTCCATACCACGACGTCTC

CDS

921 bp

>Os09t0529300-01 Similar to Leaf angle-associated protein.
ATGTCGAGTATTGCACCATCAATGAGAACAAGGGTAAGGATACCAGGATATCTCTCTTTT
ATGTACCACATGTTTTGTTGTTCTCATGTTGTCAACTCTTGTTTCTTCTCTTCTATTTTT
TTTCCTGATGGAGTAGCCATGGAAGAGAAGGAAGACTCTCTGCGTGCAAGTGTGACTGAG
CAAGACACTGAGGCCCTGCTGCTCCGTGATGTGCTTATTAATGGTATACTTGCAATTGGC
ACGCTGGGCCACAATGTAAACTCACTCTGTCCTGAGTCCTGTATTGAACAAGATGAGCCC
ATCATCATGTGTGATGAGAAAGTGGAACAAGAGAAGTGCGAAGAAGAAAAGGCTGAGGCT
AAACAGGACACACCAGTTACAGCACCAAGTGAACCGGCATCTGCTCTTGAGCCTGCCAAG
ATGCACTCATCATCGATGAAAGAAGACAACTTCATGTGCTTTGTGAAGGAGGAAATCCTA
ATGCATGGCATGGAAGTGGAAGATGTTCCTAACATCCAGGAACGACCACTTCTGATGTTA
GAGAAGGTGGAGAAAGTGAGAACTACACTTGCCGATCTATTTGCTGCAGAAGCATTCTCA
TCAAGTGATGCAGAGGATAAGTGTTACCCGAAAATCGTCATTGTTGCTGGGGCATCCACT
TCAAAGCCTACGTCGTGCATGGAGAAGATGCATCACAAGAAGCCAACAAAACCAACGTCA
AAGCCGCTGAAGGCTACAAGAAAATTAAGTCGAGTATGGTTTTCTTCGTCTCTGCTTTAT
TTGTTAAGCCTTGTTACATTATATTTTACTAGTCTGGAATTTATTACACTTTGTTCCATG
GTCAGTGCGCCACATCTTACACATATGTTTTACCATATAGCTACAACTGGAGTAAGCATT
ATGCATCTAGCCAGTCTTTAG

Protein

307 aa

>Os09t0529300-01 Similar to Leaf angle-associated protein.
MSSIAPSMRTRVRIPGYLSFMYHMFCCSHVVNSCFFSSIFFPDGVAMEEKEDSLRASVTE
QDTEALLLRDVLINGILAIGTLGHNVNSLCPESCIEQDEPIIMCDEKVEQEKCEEEKAEA
KQDTPVTAPSEPASALEPAKMHSSSMKEDNFMCFVKEEILMHGMEVEDVPNIQERPLLML
EKVEKVRTTLADLFAAEAFSSSDAEDKCYPKIVIVAGASTSKPTSCMEKMHHKKPTKPTS
KPLKATRKLSRVWFSSSLLYLLSLVTLYFTSLEFITLCSMVSAPHLTHMFYHIATTGVSI
MHLASL*

5'UTR

chr09:20734669..20734724 (- strand) : 56 bp

chr09:20734468..20734501 (- strand) : 34 bp

CDS

chr09:20733547..20734467 (- strand) : 921 bp

3'UTR

chr09:20731589..20733546 (- strand) : 1958 bp

FASTA

>Os09t0529300-01 class=Sequence position=chr09:20731589..20734724 (- strand)
TACTGTCTGG CTTTCTCTTC TGGTTTCATA TTGGTTCTAG AGAGATGGCT CTAAAGGTAC ACAGTTAGTT CATGCTGATA
CACCATTTGT CCGTGTATAG TGTATGCTGT AAAGTACAGG TCTTTGCAGT TTCTGTCTCT CTTAAACAAG TGCGTTGGAT
TCAACTCACT GTTCTTATAT CTAATGAGAT TACTGGTGAT TTATGTTTTT ATGGCACTAC CAGGTGTTCA ATTGGCTGAA
TCGGAAGAAG CATTCTAATG TCGAGTATTG CACCATCAAT GAGAACAAGG GTAAGGATAC CAGGATATCT CTCTTTTATG
TACCACATGT TTTGTTGTTC TCATGTTGTC AACTCTTGTT TCTTCTCTTC TATTTTTTTT CCTGATGGAG TAGCCATGGA
AGAGAAGGAA GACTCTCTGC GTGCAAGTGT GACTGAGCAA GACACTGAGG CCCTGCTGCT CCGTGATGTG CTTATTAATG
GTATACTTGC AATTGGCACG CTGGGCCACA ATGTAAACTC ACTCTGTCCT GAGTCCTGTA TTGAACAAGA TGAGCCCATC
ATCATGTGTG ATGAGAAAGT GGAACAAGAG AAGTGCGAAG AAGAAAAGGC TGAGGCTAAA CAGGACACAC CAGTTACAGC
ACCAAGTGAA CCGGCATCTG CTCTTGAGCC TGCCAAGATG CACTCATCAT CGATGAAAGA AGACAACTTC ATGTGCTTTG
TGAAGGAGGA AATCCTAATG CATGGCATGG AAGTGGAAGA TGTTCCTAAC ATCCAGGAAC GACCACTTCT GATGTTAGAG
AAGGTGGAGA AAGTGAGAAC TACACTTGCC GATCTATTTG CTGCAGAAGC ATTCTCATCA AGTGATGCAG AGGATAAGTG
TTACCCGAAA ATCGTCATTG TTGCTGGGGC ATCCACTTCA AAGCCTACGT CGTGCATGGA GAAGATGCAT CACAAGAAGC
CAACAAAACC AACGTCAAAG CCGCTGAAGG CTACAAGAAA ATTAAGTCGA GTATGGTTTT CTTCGTCTCT GCTTTATTTG
TTAAGCCTTG TTACATTATA TTTTACTAGT CTGGAATTTA TTACACTTTG TTCCATGGTC AGTGCGCCAC ATCTTACACA
TATGTTTTAC CATATAGCTA CAACTGGAGT AAGCATTATG CATCTAGCCA GTCTTTAGTG GTAAATGATC ACTGACCTGG
AATGCACCTT TTTGGTTTTT GTCATCTGTA AAATAAGTAG GTCATGAGGA AGATGTTGGG GAAGAAGATC CACCCAGAGC
AGCTCAATGG ACGTAGCAAT GCAGAGGGCC CTGTCACTGC ATAATGCTAG GTTTGTGGAC AAAAGTTTCC TTTCTCTATC
TGGCAATTTA TTACCTAGAG TTTTTTTAAA GCTGTCTGTT GAACTATACA GGGCTCAAGG CCCTTGTGTT TTGCATACGA
TTTTGTACCT TTCCAAATTT TCTTGATTTT TACTTGGATT CCATTGTTTG TAATAAAATT AGGTTAATAT CTGAGGTAGT
ATTTGCATAG AATGGATACC TTCTACCAAA GTTATATTTG TTTGTGGGTC CTAGAGCTAG CATGACCCAC GAATCACATT
CAAGAATATA GTAATTCGTT TAGGCTACAT TTCACTAGGA ATAGAACATA TGAATATTCT CAGGTTTAAT AAGGCAGATG
CAAAAAAGAA CTGAATAGCA CAGGAAAGTA ATTTTTCCAT TTCAAGCTTC TCACAGTCAA AAACAAGTAA TGGTTCAAAA
ATTGAATATT CTATCACCTG TTGCCTCCAT TTATGTGGAA CTCACAAGAG GGTCTAAGTG CTGCTTGACA CTCTGACCTG
TATTTAAATA AAATGTTATC ACCTATTGCC TCTGCTTATT ATTGGGATCT CAAAACACAA TCTATTACTG TGTATGCCTT
GGCATTTTTT AAAATCTGAG CTGCCCCCTT ATTCTTCACA TTTTCTCAGA AAACCATATA AACttttaga taaatgaagc
ttttattgat ctcagacaat tacatcaagt tgatagaacc aaactaagaa cacttctggc ctctgataaT GGAACTGCTG
TTTGTTTAAG TAGAAAGAAT GGTGTGTGTA TTTTAACGGT TGGTGATTGG GAATTGGGAT GCAGTGACCA TGGAGACTGT
GTTCTTCAGA ATATTTTTAA GAAATAGTGT TTTCGGTGGA TCCTATCATG GAACTGCCTA TGGTGGAAAG AGCAATACGA
GTTGAAACAT ATAGGGATTA GGAAGCATGG GTTCGGACTA AAATGCATTC GTTCCTGCCA TGATGCAAAG CTTCATTCGA
AGCAAAATGA GCACATGCCA TGGTACAGTG GCGTGCAACG AGCACTGCAA TTGCACACGA CGTGCATGTT CTGAAAAAGG
CCAGTGGACA CTAGACATGC AGCTAATCCT CTTTTGATGA ATTCTATCAT GAAACCAATG GATTCGTTGA AAATCTGAAC
AAATTGATGG ATTTGGTCCC AGCTGTAGAA AGGTTGGCAA ACTCTTCTCG CTCCTGTATT ATTGTAGGCT GGAGCTATGA
TGGACCAAAT CATCAGAAGC AAATTTCACC ATATATAAGC ATCTACTTTT ATCTTTTTCT CTATTTTAAA ATGTGATCAT
AGTGAAGTTA TATACATTCT ATCTGCTTAA CGCTCCACAT TATCCAAAAA AATGCATCAC ACTCCATATT GGGAACACGT
TGGTGGTTCT GAACCAAAGT CGATCTCTTG ATGCCAATTT TTTTTTTGAG CTGGTTGAGT AGTCGAACTG GGAACAATTA
CTGCTTGAGG CTACAAAATT TCTGGCCGAC AATACGTCTT GATCAGGAAC TGACTAAAGA AATTCCCTTT CACCTTTTGC
GGGATTTGTT GGATCCATCC TCACGCTTCG GATTCCTTGC TCAAGAGAAA CATCCATGCA TATCGTCGAC AGCGTTCGTT
CAGTCCTCTT CCTTTTGTTG TTGGTGCTGT TGTTATTATT GTTATTGTTA TTGCTGCCTA TTCGCTCGCC AGTGATGAAG
AATAGTCCTG CCTATATTTG CCTGTAGTAC ATTGTAAAGC TACAGTTGAC GTGTCTTGTA AGACCCTTAT TATTATTGTC
CATACCACGA CGTCTC