Os09t0529300-02

Locus

Os09g0529300

Description

Regulation of tiller angle

RAP-DB Gene Symbol Synonym(s)

SPK, Spk(t), Spk, OsTAC1, TAC1, qTAC9

RAP-DB Gene Name Synonym(s)

SPREADING STUB, Spreading stub, Tiller angle control 1, QTL controlling tiller angle on chromosome 9

CGSNL Gene Symbol

SPK

CGSNL Gene Name

SPREADING STUB

Oryzabase Gene Symbol Synonym(s)

Spk(t), Spk(t)*), Spk, OsTAC1, TAC1, qTAC9

Oryzabase Gene Name Synonym(s)

Spreading stub, Tiller angle control 1

Transcript Evidence

Inferred from literature

Protein Evidence

Q0J059

Literature

PMID: 28542427

PMID: 17908158

DOI: 10.1111/j.1439-0523.2009.01639.x

Note

Manual Curation

July 5, 2016

Others

Oryzabase (862)

Transcript

2640 bp

>Os09t0529300-02 Regulation of tiller angle
GAGCTACTGTCTGGCTTTCTCTTCTGGTTTCATATTGGTTCTAGAGAGATGGCTCTAAAG
GTGTTCAATTGGCTGAATCGGAAGAAGCATTCTAATGTCGAGTATTGCACCATCAATGAG
AACAAGGCCATGGAAGAGAAGGAAGACTCTCTGCGTGCAAGTGTGACTGAGCAAGACACT
GAGGCCCTGCTGCTCCGTGATGTGCTTATTAATGGTATACTTGCAATTGGCACGCTGGGC
CACAATGTAAACTCACTCTGTCCTGAGTCCTGTATTGAACAAGATGAGCCCATCATCATG
TGTGATGAGAAAGTGGAACAAGAGAAGTGCGAAGAAGAAAAGGCTGAGGCTAAACAGGAC
ACACCAGTTACAGCACCAAGTGAACCGGCATCTGCTCTTGAGCCTGCCAAGATGCACTCA
TCATCGATGAAAGAAGACAACTTCATGTGCTTTGTGAAGGAGGAAATCCTAATGCATGGC
ATGGAAGTGGAAGATGTTCCTAACATCCAGGAACGACCACTTCTGATGTTAGAGAAGGTG
GAGAAAGTGAGAACTACACTTGCCGATCTATTTGCTGCAGAAGCATTCTCATCAAGTGAT
GCAGAGGATAAGTGTTACCCGAAAATCGTCATTGTTGCTGGGGCATCCACTTCAAAGCCT
ACGTCGTGCATGGAGAAGATGCATCACAAGAAGCCAACAAAACCAACGTCAAAGCCGCTG
AAGGCTACAAGAAAATTAAGTCGAGTCATGAGGAAGATGTTGGGGAAGAAGATCCACCCA
GAGCAGCTCAATGGACGTAGCAATGCAGAGGGCCCTGTCACTGCATAATGCTAGGTTTGT
GGACAAAAGTTTCCTTTCTCTATCTGGCAATTTATTACCTAGAGTTTTTTTAAAGCTGTC
TGTTGAACTATACAGGGCTCAAGGCCCTTGTGTTTTGCATACGATTTTGTACCTTTCCAA
ATTTTCTTGATTTTTACTTGGATTCCATTGTTTGTAATAAAATTAGGTTAATATCTGAGG
TAGTATTTGCATAGAATGGATACCTTCTACCAAAGTTATATTTGTTTGTGGGTCCTAGAG
CTAGCATGACCCACGAATCACATTCAAGAATATAGTAATTCGTTTAGGCTACATTTCACT
AGGAATAGAACATATGAATATTCTCAGGTTTAATAAGGCAGATGCAAAAAAGAACTGAAT
AGCACAGGAAAGTAATTTTTCCATTTCAAGCTTCTCACAGTCAAAAACAAGTAATGGTTC
AAAAATTGAATATTCTATCACCTGTTGCCTCCATTTATGTGGAACTCACAAGAGGGTCTA
AGTGCTGCTTGACACTCTGACCTGTATTTAAATAAAATGTTATCACCTATTGCCTCTGCT
TATTATTGGGATCTCAAAACACAATCTATTACTGTGTATGCCTTGGCATTTTTTAAAATC
TGAGCTGCCCCCTTATTCTTCACATTTTCTCAGAAAACCATATAAACttttagataaatg
aagcttttattgatctcagacaattacatcaagttgatagaaccaaactaagaacacttc
tggcctctgataaTGGAACTGCTGTTTGTTTAAGTAGAAAGAATGGTGTGTGTATTTTAA
CGGTTGGTGATTGGGAATTGGGATGCAGTGACCATGGAGACTGTGTTCTTCAGAATATTT
TTAAGAAATAGTGTTTTCGGTGGATCCTATCATGGAACTGCCTATGGTGGAAAGAGCAAT
ACGAGTTGAAACATATAGGGATTAGGAAGCATGGGTTCGGACTAAAATGCATTCGTTCCT
GCCATGATGCAAAGCTTCATTCGAAGCAAAATGAGCACATGCCATGGTACAGTGGCGTGC
AACGAGCACTGCAATTGCACACGACGTGCATGTTCTGAAAAAGGCCAGTGGACACTAGAC
ATGCAGCTAATCCTCTTTTGATGAATTCTATCATGAAACCAATGGATTCGTTGAAAATCT
GAACAAATTGATGGATTTGGTCCCAGCTGTAGAAAGGTTGGCAAACTCTTCTCGCTCCTG
TATTATTGTAGGCTGGAGCTATGATGGACCAAATCATCAGAAGCAAATTTCACCATATAT
AAGCATCTACTTTTATCTTTTTCTCTATTTTAAAATGTGATCATAGTGAAGTTATATACA
TTCTATCTGCTTAACGCTCCACATTATCCAAAAAAATGCATCACACTCCATATTGGGAAC
ACGTTGGTGGTTCTGAACCAAAGTCGATCTCTTGATGCCAATTTTTTTTTTGAGCTGGTT
GAGTAGTCGAACTGGGAACAATTACTGCTTGAGGCTACAAAATTTCTGGCCGACAATACG
TCTTGATCAGGAACTGACTAAAGAAATTCCCTTTCACCTTTTGCGGGATTTGTTGGATCC
ATCCTCACGCTTCGGATTCCTTGCTCAAGAGAAACATCCATGCATATCGTCGACAGCGTT
CGTTCAGTCCTCTTCCTTTTGTTGTTGGTGCTGTTGTTATTATTGTTATTGTTATTGCTG
CCTATTCGCTCGCCAGTGATGAAGAATAGTCCTGCCTATATTTGCCTGTAGTACATTGTA
AAGCTACAGTTGACGTGTCTTGTAAGACCCTTATTATTATTGTCCATACCACGACGTCTC

CDS

780 bp

>Os09t0529300-02 Regulation of tiller angle
ATGGCTCTAAAGGTGTTCAATTGGCTGAATCGGAAGAAGCATTCTAATGTCGAGTATTGC
ACCATCAATGAGAACAAGGCCATGGAAGAGAAGGAAGACTCTCTGCGTGCAAGTGTGACT
GAGCAAGACACTGAGGCCCTGCTGCTCCGTGATGTGCTTATTAATGGTATACTTGCAATT
GGCACGCTGGGCCACAATGTAAACTCACTCTGTCCTGAGTCCTGTATTGAACAAGATGAG
CCCATCATCATGTGTGATGAGAAAGTGGAACAAGAGAAGTGCGAAGAAGAAAAGGCTGAG
GCTAAACAGGACACACCAGTTACAGCACCAAGTGAACCGGCATCTGCTCTTGAGCCTGCC
AAGATGCACTCATCATCGATGAAAGAAGACAACTTCATGTGCTTTGTGAAGGAGGAAATC
CTAATGCATGGCATGGAAGTGGAAGATGTTCCTAACATCCAGGAACGACCACTTCTGATG
TTAGAGAAGGTGGAGAAAGTGAGAACTACACTTGCCGATCTATTTGCTGCAGAAGCATTC
TCATCAAGTGATGCAGAGGATAAGTGTTACCCGAAAATCGTCATTGTTGCTGGGGCATCC
ACTTCAAAGCCTACGTCGTGCATGGAGAAGATGCATCACAAGAAGCCAACAAAACCAACG
TCAAAGCCGCTGAAGGCTACAAGAAAATTAAGTCGAGTCATGAGGAAGATGTTGGGGAAG
AAGATCCACCCAGAGCAGCTCAATGGACGTAGCAATGCAGAGGGCCCTGTCACTGCATAA

Protein

260 aa

>Os09t0529300-02 Regulation of tiller angle
MALKVFNWLNRKKHSNVEYCTINENKAMEEKEDSLRASVTEQDTEALLLRDVLINGILAI
GTLGHNVNSLCPESCIEQDEPIIMCDEKVEQEKCEEEKAEAKQDTPVTAPSEPASALEPA
KMHSSSMKEDNFMCFVKEEILMHGMEVEDVPNIQERPLLMLEKVEKVRTTLADLFAAEAF
SSSDAEDKCYPKIVIVAGASTSKPTSCMEKMHHKKPTKPTSKPLKATRKLSRVMRKMLGK
KIHPEQLNGRSNAEGPVTA*

5'UTR

chr09:20734681..20734728 (- strand) : 48 bp

CDS

chr09:20734669..20734680 (- strand) : 12 bp

chr09:20734435..20734501 (- strand) : 67 bp

chr09:20733715..20734331 (- strand) : 617 bp

chr09:20733401..20733484 (- strand) : 84 bp

3'UTR

chr09:20731589..20733400 (- strand) : 1812 bp

FASTA

>Os09t0529300-02 class=Sequence position=chr09:20731589..20734728 (- strand)
GAGCTACTGT CTGGCTTTCT CTTCTGGTTT CATATTGGTT CTAGAGAGAT GGCTCTAAAG GTACACAGTT AGTTCATGCT
GATACACCAT TTGTCCGTGT ATAGTGTATG CTGTAAAGTA CAGGTCTTTG CAGTTTCTGT CTCTCTTAAA CAAGTGCGTT
GGATTCAACT CACTGTTCTT ATATCTAATG AGATTACTGG TGATTTATGT TTTTATGGCA CTACCAGGTG TTCAATTGGC
TGAATCGGAA GAAGCATTCT AATGTCGAGT ATTGCACCAT CAATGAGAAC AAGGGTAAGG ATACCAGGAT ATCTCTCTTT
TATGTACCAC ATGTTTTGTT GTTCTCATGT TGTCAACTCT TGTTTCTTCT CTTCTATTTT TTTTCCTGAT GGAGTAGCCA
TGGAAGAGAA GGAAGACTCT CTGCGTGCAA GTGTGACTGA GCAAGACACT GAGGCCCTGC TGCTCCGTGA TGTGCTTATT
AATGGTATAC TTGCAATTGG CACGCTGGGC CACAATGTAA ACTCACTCTG TCCTGAGTCC TGTATTGAAC AAGATGAGCC
CATCATCATG TGTGATGAGA AAGTGGAACA AGAGAAGTGC GAAGAAGAAA AGGCTGAGGC TAAACAGGAC ACACCAGTTA
CAGCACCAAG TGAACCGGCA TCTGCTCTTG AGCCTGCCAA GATGCACTCA TCATCGATGA AAGAAGACAA CTTCATGTGC
TTTGTGAAGG AGGAAATCCT AATGCATGGC ATGGAAGTGG AAGATGTTCC TAACATCCAG GAACGACCAC TTCTGATGTT
AGAGAAGGTG GAGAAAGTGA GAACTACACT TGCCGATCTA TTTGCTGCAG AAGCATTCTC ATCAAGTGAT GCAGAGGATA
AGTGTTACCC GAAAATCGTC ATTGTTGCTG GGGCATCCAC TTCAAAGCCT ACGTCGTGCA TGGAGAAGAT GCATCACAAG
AAGCCAACAA AACCAACGTC AAAGCCGCTG AAGGCTACAA GAAAATTAAG TCGAGTATGG TTTTCTTCGT CTCTGCTTTA
TTTGTTAAGC CTTGTTACAT TATATTTTAC TAGTCTGGAA TTTATTACAC TTTGTTCCAT GGTCAGTGCG CCACATCTTA
CACATATGTT TTACCATATA GCTACAACTG GAGTAAGCAT TATGCATCTA GCCAGTCTTT AGTGGTAAAT GATCACTGAC
CTGGAATGCA CCTTTTTGGT TTTTGTCATC TGTAAAATAA GTAGGTCATG AGGAAGATGT TGGGGAAGAA GATCCACCCA
GAGCAGCTCA ATGGACGTAG CAATGCAGAG GGCCCTGTCA CTGCATAATG CTAGGTTTGT GGACAAAAGT TTCCTTTCTC
TATCTGGCAA TTTATTACCT AGAGTTTTTT TAAAGCTGTC TGTTGAACTA TACAGGGCTC AAGGCCCTTG TGTTTTGCAT
ACGATTTTGT ACCTTTCCAA ATTTTCTTGA TTTTTACTTG GATTCCATTG TTTGTAATAA AATTAGGTTA ATATCTGAGG
TAGTATTTGC ATAGAATGGA TACCTTCTAC CAAAGTTATA TTTGTTTGTG GGTCCTAGAG CTAGCATGAC CCACGAATCA
CATTCAAGAA TATAGTAATT CGTTTAGGCT ACATTTCACT AGGAATAGAA CATATGAATA TTCTCAGGTT TAATAAGGCA
GATGCAAAAA AGAACTGAAT AGCACAGGAA AGTAATTTTT CCATTTCAAG CTTCTCACAG TCAAAAACAA GTAATGGTTC
AAAAATTGAA TATTCTATCA CCTGTTGCCT CCATTTATGT GGAACTCACA AGAGGGTCTA AGTGCTGCTT GACACTCTGA
CCTGTATTTA AATAAAATGT TATCACCTAT TGCCTCTGCT TATTATTGGG ATCTCAAAAC ACAATCTATT ACTGTGTATG
CCTTGGCATT TTTTAAAATC TGAGCTGCCC CCTTATTCTT CACATTTTCT CAGAAAACCA TATAAACttt tagataaatg
aagcttttat tgatctcaga caattacatc aagttgatag aaccaaacta agaacacttc tggcctctga taaTGGAACT
GCTGTTTGTT TAAGTAGAAA GAATGGTGTG TGTATTTTAA CGGTTGGTGA TTGGGAATTG GGATGCAGTG ACCATGGAGA
CTGTGTTCTT CAGAATATTT TTAAGAAATA GTGTTTTCGG TGGATCCTAT CATGGAACTG CCTATGGTGG AAAGAGCAAT
ACGAGTTGAA ACATATAGGG ATTAGGAAGC ATGGGTTCGG ACTAAAATGC ATTCGTTCCT GCCATGATGC AAAGCTTCAT
TCGAAGCAAA ATGAGCACAT GCCATGGTAC AGTGGCGTGC AACGAGCACT GCAATTGCAC ACGACGTGCA TGTTCTGAAA
AAGGCCAGTG GACACTAGAC ATGCAGCTAA TCCTCTTTTG ATGAATTCTA TCATGAAACC AATGGATTCG TTGAAAATCT
GAACAAATTG ATGGATTTGG TCCCAGCTGT AGAAAGGTTG GCAAACTCTT CTCGCTCCTG TATTATTGTA GGCTGGAGCT
ATGATGGACC AAATCATCAG AAGCAAATTT CACCATATAT AAGCATCTAC TTTTATCTTT TTCTCTATTT TAAAATGTGA
TCATAGTGAA GTTATATACA TTCTATCTGC TTAACGCTCC ACATTATCCA AAAAAATGCA TCACACTCCA TATTGGGAAC
ACGTTGGTGG TTCTGAACCA AAGTCGATCT CTTGATGCCA ATTTTTTTTT TGAGCTGGTT GAGTAGTCGA ACTGGGAACA
ATTACTGCTT GAGGCTACAA AATTTCTGGC CGACAATACG TCTTGATCAG GAACTGACTA AAGAAATTCC CTTTCACCTT
TTGCGGGATT TGTTGGATCC ATCCTCACGC TTCGGATTCC TTGCTCAAGA GAAACATCCA TGCATATCGT CGACAGCGTT
CGTTCAGTCC TCTTCCTTTT GTTGTTGGTG CTGTTGTTAT TATTGTTATT GTTATTGCTG CCTATTCGCT CGCCAGTGAT
GAAGAATAGT CCTGCCTATA TTTGCCTGTA GTACATTGTA AAGCTACAGT TGACGTGTCT TGTAAGACCC TTATTATTAT
TGTCCATACC ACGACGTCTC