Os09t0529700-01

Locus

Os09g0529700

Description

Similar to EAP30 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsVPS22

Oryzabase Gene Name Synonym(s)

VPS22 component of ESCRT-II complex, ESCRT-II complex VPS22 component

Transcript Evidence

AK243545 (DDBJ, Best hit)

Protein Evidence

A6MD19 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

EAP30 (IPR007286)

ESCRT-2 complex, Snf8 (IPR016689)

Full-length cDNA

J100079C15 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0529700-01)

Others

Oryzabase (12257)

KEGG (Os09t0529700-01)

Transcript

1647 bp

>Os09t0529700-01 Similar to EAP30 family protein.
CCCAAACATCATcgcctctcgccgtcgtctcgtctcttcctctgcggctgaactagtcgc
cgatccagaggccgtcgtccactcgcggtcccaccggccaccgcctccgccgcctctcac
cggcgccaccgctgctctgcCTCCACCGCGTTCCTCCTCTCCACAAGCCTCGGTCGCCCA
GTACGCATCCCATCCGTCGCCGTCGACCTAGCTGCCTGGTGGAGGTGGAGGCGAGGGGGA
TTGACTCGGCTCCGGCGCTCCGATTGAGCCCGCAGCCGACCGATCCGGATACGATCCGCT
CCGCTCCTCGCCGGAGCGGAGGCTGTCGCGAACCCAGGTAACATCCCCGCCCTAACCTCC
CACGCCGCACGCACGCGAAGGCCGACGGCGGCAGCGCCATCCCCTGACGGCCGACTGCGC
AGCGGCGCTCCGCCCCGCGCCCCGGCCTGGGCCTGCCCGCCTTCGGCCTTCCCCGACTCG
CGCCGCTGCTGCGCCCCGCCGTGCAGCCGTTGCCTTCGCCCTTCGCGTCGGCGCTGCCGT
GTCGTCGCTCCGTGCAGCGCCGTCGCGCGCGGCGCGCCCGCTGCCCGGCATCCGGCCCTC
CCCCAAGCCCCAGCCCCCTTGGACTCCGCCAATTTAGACTAGGAAGCATGAGGAGGCGAC
CGGGAATCGCGGGCTTGCAGAACGCAGCGGCTACTCGTGACCAATTCCGGCTGGTTGGGG
AAAATGTGGCCAAGGTCAGGACCGATGTCATGAAGGAGCAGCTTGCGACGTTTCGGACAC
AGCTCGAAGAATTTGCACGCAAGCATAAGAATGATATCCGTAAAAATCCACTATTTAGAC
AACAGTTCCATGAGATGTGTGCAAAAGTTGGAGTAGACCCGCTGGCTTCGAATAAAGGAG
CTTGGGCAGAGCTTCTAGGGATTGGTGACTTCTACTATGAATTGGGAGTTCAGATTGTTG
ACATATGCATAGCAACCAGAGCGACCAACGGTGGCTTGATTGACTTGCTAGATCTCCGTA
AACTCCTCTGTCAGAAGAGGAAAGCTGATCTTGGATCGTTAACATCAGATGATTGTTTGC
GTGCGATAAGTAAGCTGAAGGTCCTTGGTAGTGGTTTTGAAGTAATTTCTGTTGGGAAGA
AAAAGCTTGTGCGTTCTGTTCCTACAGAACTGAATAAAGATCACAATGGGATACTTGAGC
TAGCTCAGGCTGAAGGTTTTGTCACCGTAGAGCAAGTCGAGAGAAAGTTCTCGTGGTCAA
CTGGCCGTGCCATTGACGTCCTTGAAACTTTGCTCAAGGAAGGGCTTGCGATGATCGACG
ATGGGCACAGGGATGGCAAGCGCAGATACTGGTTCCCGTGCGTCACTCTCAGCTCTGACT
CTACTGGTGCGGATGCCAAGTCATGACCTGTGCCGTGCCTGTTCCACTCCGTTGTTGTCA
CCTGTATCCTTTTCCATTGGTTCATTTCTGTAGGCACTGAAGCACATATGGCATGCCATT
TACCAGTACAGCTCTGGAAGAATCATGAGATAGCAATACACTTTTCAGGGCTGGGCTGCC
GGCAAAATTTTTACATTGTGATTCGTGCATCAGGATTCTGGATGTATTTGTACTAGTGAT
CTATACTATACTAGCTCTTCTTTCACG

CDS

759 bp

>Os09t0529700-01 Similar to EAP30 family protein.
ATGAGGAGGCGACCGGGAATCGCGGGCTTGCAGAACGCAGCGGCTACTCGTGACCAATTC
CGGCTGGTTGGGGAAAATGTGGCCAAGGTCAGGACCGATGTCATGAAGGAGCAGCTTGCG
ACGTTTCGGACACAGCTCGAAGAATTTGCACGCAAGCATAAGAATGATATCCGTAAAAAT
CCACTATTTAGACAACAGTTCCATGAGATGTGTGCAAAAGTTGGAGTAGACCCGCTGGCT
TCGAATAAAGGAGCTTGGGCAGAGCTTCTAGGGATTGGTGACTTCTACTATGAATTGGGA
GTTCAGATTGTTGACATATGCATAGCAACCAGAGCGACCAACGGTGGCTTGATTGACTTG
CTAGATCTCCGTAAACTCCTCTGTCAGAAGAGGAAAGCTGATCTTGGATCGTTAACATCA
GATGATTGTTTGCGTGCGATAAGTAAGCTGAAGGTCCTTGGTAGTGGTTTTGAAGTAATT
TCTGTTGGGAAGAAAAAGCTTGTGCGTTCTGTTCCTACAGAACTGAATAAAGATCACAAT
GGGATACTTGAGCTAGCTCAGGCTGAAGGTTTTGTCACCGTAGAGCAAGTCGAGAGAAAG
TTCTCGTGGTCAACTGGCCGTGCCATTGACGTCCTTGAAACTTTGCTCAAGGAAGGGCTT
GCGATGATCGACGATGGGCACAGGGATGGCAAGCGCAGATACTGGTTCCCGTGCGTCACT
CTCAGCTCTGACTCTACTGGTGCGGATGCCAAGTCATGA

Protein

253 aa

>Os09t0529700-01 Similar to EAP30 family protein.
MRRRPGIAGLQNAAATRDQFRLVGENVAKVRTDVMKEQLATFRTQLEEFARKHKNDIRKN
PLFRQQFHEMCAKVGVDPLASNKGAWAELLGIGDFYYELGVQIVDICIATRATNGGLIDL
LDLRKLLCQKRKADLGSLTSDDCLRAISKLKVLGSGFEVISVGKKKLVRSVPTELNKDHN
GILELAQAEGFVTVEQVERKFSWSTGRAIDVLETLLKEGLAMIDDGHRDGKRRYWFPCVT
LSSDSTGADAKS*

5'UTR

chr09:20747882..20748509 (- strand) : 628 bp

chr09:20747330..20747348 (- strand) : 19 bp

CDS

chr09:20747279..20747329 (- strand) : 51 bp

chr09:20747078..20747188 (- strand) : 111 bp

chr09:20746387..20746522 (- strand) : 136 bp

chr09:20746127..20746282 (- strand) : 156 bp

chr09:20745856..20745962 (- strand) : 107 bp

chr09:20745476..20745565 (- strand) : 90 bp

chr09:20745079..20745186 (- strand) : 108 bp

3'UTR

chr09:20744838..20745078 (- strand) : 241 bp

FASTA

>Os09t0529700-01 class=Sequence position=chr09:20744838..20748509 (- strand)
CCCAAACATC ATcgcctctc gccgtcgtct cgtctcttcc tctgcggctg aactagtcgc cgatccagag gccgtcgtcc
actcgcggtc ccaccggcca ccgcctccgc cgcctctcac cggcgccacc gctgctctgc CTCCACCGCG TTCCTCCTCT
CCACAAGCCT CGGTCGCCCA GTACGCATCC CATCCGTCGC CGTCGACCTA GCTGCCTGGT GGAGGTGGAG GCGAGGGGGA
TTGACTCGGC TCCGGCGCTC CGATTGAGCC CGCAGCCGAC CGATCCGGAT ACGATCCGCT CCGCTCCTCG CCGGAGCGGA
GGCTGTCGCG AACCCAGGTA ACATCCCCGC CCTAACCTCC CACGCCGCAC GCACGCGAAG GCCGACGGCG GCAGCGCCAT
CCCCTGACGG CCGACTGCGC AGCGGCGCTC CGCCCCGCGC CCCGGCCTGG GCCTGCCCGC CTTCGGCCTT CCCCGACTCG
CGCCGCTGCT GCGCCCCGCC GTGCAGCCGT TGCCTTCGCC CTTCGCGTCG GCGCTGCCGT GTCGTCGCTC CGTGCAGCGC
CGTCGCGCGC GGCGCGCCCG CTGCCCGGCA TCCGGCCCTC CCCCAAGCCC CAGCCCCCTT GGACTCCGGT GAGCACTGCC
TCTCGCCCTC TCCGGCTCTC CCTCTACCTC AGTCCCTCTC CCCCTTCTAG TAGACCACAG TATTATCCCC TTCAATAATC
AATTTCTTTG TATGATTGTA TCTGTGATTA GCCAATTAGG GATATAGTAA TTTGTATAGA TTACTACAAA ATTATGTGCA
ACAATGAACC TCAAATGAAA TTTTTGACTT GTATTGTAAT ATCCTATTTA TCTAAGATGT TATGTTATGT TTGAACAATT
TACATTGTCC TTTAGGTAAG ATTCAAACTT GTTTGTTATT TTCTACTTGT ATTGAACCAT TTAGAGTTAT ATACCGTATC
ACGGTATCGT TTATAATTTA TCAGATATCT TATCGAATCA taccgtattg catttagatt tttttttgct aggcctaccc
cgggttcaaa tcctgggtcc gccactgTTA GAACACACGC AGAGAACTCT GGCCACATCG AATCGATCGC CGTTCACGAG
ATGTGCTAAT TGATTCCATC GGATTTTTTA TGGAACTGCA GCCAATTTAG ACTAGGAAGC ATGAGGAGGC GACCGGGAAT
CGCGGGCTTG CAGAACGCAG CGGCTACTCG TGTATGTGGA CATCTTGCTT GAATAGCTTA TAATGTTTTT TTTTTCTTTT
TCTGTGGATT CTGAGATGAG TGTGCTCTTG GAAAATTTAA GGACCAATTC CGGCTGGTTG GGGAAAATGT GGCCAAGGTC
AGGACCGATG TCATGAAGGA GCAGCTTGCG ACGTTTCGGA CACAGCTCGA AGAATTTGCA CGCAAGCATA AGGTGATTCC
TACTCCTGTA TTCTAGTTGA GTTTTACAGA AAATATTACC GACGCTATTC GTATGTCACA AATTGAATTA CACATAGCAT
GCTTTCACAA TCTTCTTAAT CTTGGGGATC AGGATATATC AGTCATTCTT GCAGACTGAC TGAATTCTTA CATTTTTTTT
CAACTGCCCA GCGCAAATGA AATGAATGTT CTAACAAACA TGAAAACAGT GAAGTTACTG CTATTCACTT GATTAAAGTT
GTCTATCGAA CTGGGAAATA GGGAACCTAA GTAGCATACT AGTCCATGGT CAAGTGCTCA ACATATACTA AAACTGAGGA
ACGGTAGTTA AAGATGGAAA ATGTACCAAA GAAAAGGTGT TGGAGTTACC AAGGTGCCAA TTGATCTTGT TTCTTGTGAT
AGATTTCACT TGTCTCATGG CATCTAGTTC CAACTGGGTT GACATTTGCA ATGTAACACT GATGTTCTAG GTGATCACAA
TAGAGCTCAA ATGGCACAGC ATATTCCAAC TCTTAAGTAA CTTTGTGTAC ATGGTGTGCT AGTGCAGAAT GATATCCGTA
AAAATCCACT ATTTAGACAA CAGTTCCATG AGATGTGTGC AAAAGTTGGA GTAGACCCGC TGGCTTCGAA TAAAGGAGCT
TGGGCAGAGC TTCTAGGGAT TGGTGACTTC TACTATGAAT TGGGTTGGTA TACTTAATTT AAGCTACCTT GTATGTTTTG
ATCCTGGAAT TTTCTGTTAT TATTGGACCA TTTACGTTCT GCTTGGCATC TGTGTCTATT GCACCAGGAG TTCAGATTGT
TGACATATGC ATAGCAACCA GAGCGACCAA CGGTGGCTTG ATTGACTTGC TAGATCTCCG TAAACTCCTC TGTCAGAAGA
GGAAAGCTGA TCTTGGATCG TTAACATCAG ATGATTGTTT GCGTGCGATA AGTAAGCTGA AGGCAAGTAT TTTAAGGAAT
TCTACAGCTA CATTTTTTTG GGAATCCTGT AATTGCATTC ATGCAAGTTT TACAAGATTG CATTCGAATC TATGGCCAAT
AAAATTTTAT TTGATGTACT TGGACAGATC GTTAATTCTT CTGGTCCTTT GCCTGTGAAC TCTCAGGTCC TTGGTAGTGG
TTTTGAAGTA ATTTCTGTTG GGAAGAAAAA GCTTGTGCGT TCTGTTCCTA CAGAACTGAA TAAAGATCAC AATGGGATAC
TTGAGCTAGC TCAGGTTTGT AATCAGCTTT TAATAGTGTA TAATACCACA GTACACTTAA CAAGTATGTG GATGCTGTCA
TAACCTTATC ATGCTTACAC TGAACAAGTA TGTGGATGGT GTATAACCTT TGGTTGGAAG TCATAAAGCC CCCTATGTTC
CACATAAACG CTTATTTCAG TCAACATAGA GACATAGTAC AAAACTAAGT TAAACCGAAG CTTTCAAGTT GCTGCCTTGC
TCAATCTGTC ACCTTGCCAC AATATAACCG TACCTGTCCA GTTATAACAT TATTTCACAT GCAGGCTGAA GGTTTTGTCA
CCGTAGAGCA AGTCGAGAGA AAGTTCTCGT GGTCAACTGG CCGTGCCATT GACGTCCTTG AAACTTTGCT CAAGGTAAAT
CCTGCTCCTG CATTTCCACT CTTTAAGCAA CCTTTGTGCT TCATTTCTGT GCCCAAAGAA AAGAAAACCG GCTTCCTTTG
ATGCAAGTTA TGTATTGGTG AATGGTGATT AGATCTCTCT GTTGAATCCA CGCTTAAGCC ATTGCAGGAT TACCTTCTTT
TTGAGCTATC CATAATCCAT ATATAAATAA AGTACTTTTC GTATGTGCAT CTGTATTGAC ACTTTTATGA ACGTCAAATT
TTTTGGCATC TATATCCAAC TCTGGTCTCT ATTACATAAA CAGGAAGGGC TTGCGATGAT CGACGATGGG CACAGGGATG
GCAAGCGCAG ATACTGGTTC CCGTGCGTCA CTCTCAGCTC TGACTCTACT GGTGCGGATG CCAAGTCATG ACCTGTGCCG
TGCCTGTTCC ACTCCGTTGT TGTCACCTGT ATCCTTTTCC ATTGGTTCAT TTCTGTAGGC ACTGAAGCAC ATATGGCATG
CCATTTACCA GTACAGCTCT GGAAGAATCA TGAGATAGCA ATACACTTTT CAGGGCTGGG CTGCCGGCAA AATTTTTACA
TTGTGATTCG TGCATCAGGA TTCTGGATGT ATTTGTACTA GTGATCTATA CTATACTAGC TCTTCTTTCA CG