Os09t0532400-01

Locus

Os09g0532400

Description

Circadian-associated rice pseudo response regulator, Control of flowering time

RAP-DB Gene Symbol Synonym(s)

OsPRR95

RAP-DB Gene Name Synonym(s)

Pseudo-Response Regulator 95

CGSNL Gene Symbol

PRR95

CGSNL Gene Name

PSEUDO-RESPONSE REGULATOR 95

Oryzabase Gene Symbol Synonym(s)

OsPRR95, Os-PRR95, Prr2, OsPRR2, OsCCT33

Oryzabase Gene Name Synonym(s)

pseudo-response regulator 2, CCT domain-containing gene 33, CCT (CO, CO-LIKE and TOC1) domain protein 33, CCT domain protein 33

Transcript Evidence

AB189041

AK067728

Protein Evidence

Q689G6

Literature

PMID: 17132630

PMID: 15725670

PMID: 14634161

Note

Manual Curation

September 6, 2017

Gene Ontology (GO)

Biological Process: phosphorelay signal transduction system (GO:0000160)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

CheY-like superfamily (IPR011006)

Signal transduction response regulator, receiver domain (IPR001789)

CCT domain (IPR010402)

Full-length cDNA

J013116P12 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0532400-01)

RiceXPro (AK067728)

Others

Oryzabase (8821)

KEGG (Os09t0532400-01)

Transcript

2398 bp

>Os09t0532400-01 Circadian-associated rice pseudo response regulator, Control of flowering time
ATTTTCCTAGTGGCGAGCTCGAGGAGAGAGAGAGAGGAGGAGGAGAGGTGGTTGCGCCTT
GCGCGGTGAAAGGGTAGTTACCGCCGCGGGCGACTCCGGCGAGGAGGGGCGAGGGGCGGA
GCTAGCGGCGGGGGAATGGGGGGTGGAGTGGAGGAGAGGAAGGTGGTGGACTTGGAGGAC
GGGGACGGGGAGGAAGGGGAGGATGCGGCGGCGGTGGCGGCGGGGTCGAGCAGGGAGACG
CGGATGCTGCCGAGGATGCCGGTGCGGGTGCTGCTCGCTGAGGGCGACGACTCCACGCGC
CACATCATCTGCGCGCTGCTCCGCAAGTGCGGGTATCGAGTTGCCGCAGCCTCTGATGGT
GTGAAAGCGTGGGACATACTAAAGGAAAAATCTTTCAATATAGACCTTGTTTTAACTGAA
GTTGAACTTCCCTTGATGTCTGGGTTCCTGCTGCTCTCCACGATCATGGAACATGACGCA
TGCAAGAATATCCCCGTCATAATGATGTCTTCAAATGATTCCGTTAGCATGGTTTTCAAA
TGCATGCTAAAGGGTGCTGCAGATTTCCTTGTTAAGCCAATACGGAAGAATGAATTAAGG
AACTTATGGCAGCATGTTTGGAGAAAACAACTGTCCAGCGGTGTTCTTGATGTGCAGCAT
ACTCAACAAGAAGATAATCTTACAGAAAGGCATGAGCAGAAGACCGGAGTGACGAAAGCT
GAACATGTGACTGAAAATGTTGTCCACAAGAACATGGAATGCAGTGAACAAGAAAGTGAT
GCTCAAAGTTCATGTACAAGGTCAGAACTGGAGGCTGACAGTAGGCAAACCAACAATTTA
CTGGAATATAAGCAGCCAATGGGAAGGCATTTCTCCAAGCCTGACCACAAGAACACCGAG
AAAAATGGAGGGACTAAAATTCATGCATCTAATGATGGCAACTTGATTCCACGGAGGGAA
GAGGATGCATCACTGAGGAGGATGACATGTTCAAATGATATTAATTGTGAGAAAGCTTCC
AGGGATATGGAGCTGGTTCATATTATTGACAATCAGCAGAAGAATAACACACATATGGAG
ATGGATGTTGCGAGAGCAAATTCCCGTGGAAATGATGACAAGTGCTTTTCCATTCCAGCA
CACCAGTTAGAACTTTCTCTCAGAAGATCTGACTACAGTAGATTAGAGAGCCAGGAGAAA
AATGAACGAAGAACACTGAACCACTCAACTTCATCTCCATTTTCCTTGTACAACTGCAGG
ACAGCATCATCTACCATTAATGCTGGTGATGCTCAGGCATGCAGCACCTCGGCAACACAT
ATAGATCTTGAAAACAAAAATGGAGATTCCAAAACTCCCTCTCAAGACAAGAGGGAAACA
AACCAACCTCCCATTAGAGTTGTACCATTTCCTGTTCCTGTTGGAGGACTAACATTTGAT
GGGCAGCCATTCTGGAACGGTGCACCTGTGGCATCCCTTTTCTATCCACAATCAGCTCCT
CCCATTTGGAATAGCAAAACATCTACCTGGCAAGACGCAACCACACAAGCAATTTCTCTG
CAGCAGAATGGTCCAAAAGATACGGATACTAAGCAGGTTGAAAATGTAGAGGAACAAACT
GCTCGGAGTCATCTAAGTGCTAATCGGAAACATCTCCGCATTGAAATTCCTACAGATGAG
CCGCGGCATGTTTCTCCAACCACCGGTGAAAGTGGGAGCAGCACTGTGCTGGACAGCGCC
AGAAAAACGCTCAGTGGCAGTGTCTGTGACAGCTCTTCCAACCACATGATTGCCCCTACT
GAATCATCAAATGTTGTTCCTGAAAATCCTGATGGTTTACGCCACCTGAGCCAACGAGAG
GCTGCACTGAACAAGTTCCGGCTTAAGAGGAAAGACAGGTGCTTTGAGAAGAAGGTGCGA
TACCAGAGCAGGAAGCTACTAGCCGAGCAGCGACCGCGGGTTAAGGGTCAGTTTGTTCGG
CAAGATCATGGTGTCCAAGGGAGCTAGGGCTGTCCAAACTTCAGGAGATTGCTGTGCCAC
GGTTATCCTGGTGGTCAGTGTCAGATTTTGTTTGAAGAGTGAAAGTATGATTGCCCTGAC
CTACAGTCAGCAGTGTATGGTGGTGTTGCATATATATACAGGCTAACTTCGTGTGCTAGG
TTAGGCCATGGACCTCGTACATTGTAGAGTTTGTCAGTAGGGATCATATTTTGCTTCAGA
TCTAGATAAGCTGCGTTTATCATGTAGCACACGTATTTATGTTTTCTAAATTGTATCTAG
CCAACAGTTAACGTGTAAGCTGGACGTGTGTGGATGTAAGGTGTCAAGGATATCCAAAGA
CAAAGTTCTTTTGTACAGTTTCTTACACTGAACATCGTTGGTGTAGTTTCATACTTTC

CDS

1872 bp

>Os09t0532400-01 Circadian-associated rice pseudo response regulator, Control of flowering time
ATGGGGGGTGGAGTGGAGGAGAGGAAGGTGGTGGACTTGGAGGACGGGGACGGGGAGGAA
GGGGAGGATGCGGCGGCGGTGGCGGCGGGGTCGAGCAGGGAGACGCGGATGCTGCCGAGG
ATGCCGGTGCGGGTGCTGCTCGCTGAGGGCGACGACTCCACGCGCCACATCATCTGCGCG
CTGCTCCGCAAGTGCGGGTATCGAGTTGCCGCAGCCTCTGATGGTGTGAAAGCGTGGGAC
ATACTAAAGGAAAAATCTTTCAATATAGACCTTGTTTTAACTGAAGTTGAACTTCCCTTG
ATGTCTGGGTTCCTGCTGCTCTCCACGATCATGGAACATGACGCATGCAAGAATATCCCC
GTCATAATGATGTCTTCAAATGATTCCGTTAGCATGGTTTTCAAATGCATGCTAAAGGGT
GCTGCAGATTTCCTTGTTAAGCCAATACGGAAGAATGAATTAAGGAACTTATGGCAGCAT
GTTTGGAGAAAACAACTGTCCAGCGGTGTTCTTGATGTGCAGCATACTCAACAAGAAGAT
AATCTTACAGAAAGGCATGAGCAGAAGACCGGAGTGACGAAAGCTGAACATGTGACTGAA
AATGTTGTCCACAAGAACATGGAATGCAGTGAACAAGAAAGTGATGCTCAAAGTTCATGT
ACAAGGTCAGAACTGGAGGCTGACAGTAGGCAAACCAACAATTTACTGGAATATAAGCAG
CCAATGGGAAGGCATTTCTCCAAGCCTGACCACAAGAACACCGAGAAAAATGGAGGGACT
AAAATTCATGCATCTAATGATGGCAACTTGATTCCACGGAGGGAAGAGGATGCATCACTG
AGGAGGATGACATGTTCAAATGATATTAATTGTGAGAAAGCTTCCAGGGATATGGAGCTG
GTTCATATTATTGACAATCAGCAGAAGAATAACACACATATGGAGATGGATGTTGCGAGA
GCAAATTCCCGTGGAAATGATGACAAGTGCTTTTCCATTCCAGCACACCAGTTAGAACTT
TCTCTCAGAAGATCTGACTACAGTAGATTAGAGAGCCAGGAGAAAAATGAACGAAGAACA
CTGAACCACTCAACTTCATCTCCATTTTCCTTGTACAACTGCAGGACAGCATCATCTACC
ATTAATGCTGGTGATGCTCAGGCATGCAGCACCTCGGCAACACATATAGATCTTGAAAAC
AAAAATGGAGATTCCAAAACTCCCTCTCAAGACAAGAGGGAAACAAACCAACCTCCCATT
AGAGTTGTACCATTTCCTGTTCCTGTTGGAGGACTAACATTTGATGGGCAGCCATTCTGG
AACGGTGCACCTGTGGCATCCCTTTTCTATCCACAATCAGCTCCTCCCATTTGGAATAGC
AAAACATCTACCTGGCAAGACGCAACCACACAAGCAATTTCTCTGCAGCAGAATGGTCCA
AAAGATACGGATACTAAGCAGGTTGAAAATGTAGAGGAACAAACTGCTCGGAGTCATCTA
AGTGCTAATCGGAAACATCTCCGCATTGAAATTCCTACAGATGAGCCGCGGCATGTTTCT
CCAACCACCGGTGAAAGTGGGAGCAGCACTGTGCTGGACAGCGCCAGAAAAACGCTCAGT
GGCAGTGTCTGTGACAGCTCTTCCAACCACATGATTGCCCCTACTGAATCATCAAATGTT
GTTCCTGAAAATCCTGATGGTTTACGCCACCTGAGCCAACGAGAGGCTGCACTGAACAAG
TTCCGGCTTAAGAGGAAAGACAGGTGCTTTGAGAAGAAGGTGCGATACCAGAGCAGGAAG
CTACTAGCCGAGCAGCGACCGCGGGTTAAGGGTCAGTTTGTTCGGCAAGATCATGGTGTC
CAAGGGAGCTAG

Protein

624 aa

>Os09t0532400-01 Circadian-associated rice pseudo response regulator, Control of flowering time
MGGGVEERKVVDLEDGDGEEGEDAAAVAAGSSRETRMLPRMPVRVLLAEGDDSTRHIICA
LLRKCGYRVAAASDGVKAWDILKEKSFNIDLVLTEVELPLMSGFLLLSTIMEHDACKNIP
VIMMSSNDSVSMVFKCMLKGAADFLVKPIRKNELRNLWQHVWRKQLSSGVLDVQHTQQED
NLTERHEQKTGVTKAEHVTENVVHKNMECSEQESDAQSSCTRSELEADSRQTNNLLEYKQ
PMGRHFSKPDHKNTEKNGGTKIHASNDGNLIPRREEDASLRRMTCSNDINCEKASRDMEL
VHIIDNQQKNNTHMEMDVARANSRGNDDKCFSIPAHQLELSLRRSDYSRLESQEKNERRT
LNHSTSSPFSLYNCRTASSTINAGDAQACSTSATHIDLENKNGDSKTPSQDKRETNQPPI
RVVPFPVPVGGLTFDGQPFWNGAPVASLFYPQSAPPIWNSKTSTWQDATTQAISLQQNGP
KDTDTKQVENVEEQTARSHLSANRKHLRIEIPTDEPRHVSPTTGESGSSTVLDSARKTLS
GSVCDSSSNHMIAPTESSNVVPENPDGLRHLSQREAALNKFRLKRKDRCFEKKVRYQSRK
LLAEQRPRVKGQFVRQDHGVQGS*

5'UTR

chr09:20889658..20889792 (- strand) : 135 bp

CDS

chr09:20889453..20889657 (- strand) : 205 bp

chr09:20888568..20888729 (- strand) : 162 bp

chr09:20888345..20888475 (- strand) : 131 bp

chr09:20888067..20888219 (- strand) : 153 bp

chr09:20887255..20887393 (- strand) : 139 bp

chr09:20886804..20887125 (- strand) : 322 bp

chr09:20885782..20886448 (- strand) : 667 bp

chr09:20885589..20885681 (- strand) : 93 bp

3'UTR

chr09:20885198..20885588 (- strand) : 391 bp

FASTA

>Os09t0532400-01 class=Sequence position=chr09:20885198..20889792 (- strand)
ATTTTCCTAG TGGCGAGCTC GAGGAGAGAG AGAGAGGAGG AGGAGAGGTG GTTGCGCCTT GCGCGGTGAA AGGGTAGTTA
CCGCCGCGGG CGACTCCGGC GAGGAGGGGC GAGGGGCGGA GCTAGCGGCG GGGGAATGGG GGGTGGAGTG GAGGAGAGGA
AGGTGGTGGA CTTGGAGGAC GGGGACGGGG AGGAAGGGGA GGATGCGGCG GCGGTGGCGG CGGGGTCGAG CAGGGAGACG
CGGATGCTGC CGAGGATGCC GGTGCGGGTG CTGCTCGCTG AGGGCGACGA CTCCACGCGC CACATCATCT GCGCGCTGCT
CCGCAAGTGC GGGTATCGAG GTGAGCGTCT GTGCCGCACA GTTTGTTTTT GATCCGGTTA AATTGGTTGA CTGCTTTTGT
TCATTGTTTT TTGCTCGAAT TGTTGTCACG AGTGGCTAAT CTCACTAGTG AAGTTGCAAA GTTGCGGATG TTTCTGCGCT
GTAAAACTGT TACTACGTGG CAGCTGATTT TACTGGATTA GACCTCAAGT GGGGAGATTT GGGATGTGAC GATTTGTGAT
CTGTTTTTTT TTTCAGAAGA TATGTTAATC AATATGCTGA TTTTGGTCTG TAGTTGTAAT TCCTTGCTAT CTGTCTCTTT
TTCTTTATTT TGCCAGAGCT GCTTCAGTAG ACGAAATTTG GTGTAGTGCA GCCTATTCGT CAGGAATACC TAAGTTGAGG
CATTACCGAA TATCATTTTT TTTTCGAAAA AAATATAGCT GTATTTTAAC GATCCATTTC GTATCTTGTG TTAAATTGAA
ATAACTACAC ATGTATATTT GTTTTTTTCC TGAAGCAAAA TGTTTACCTG TATATTTGAT CCTTTTTTGG GACAGAGTTA
GAGCTGAAAA ATGCAGTTTC CTCTTTTAAA ACAAAAAAAA AGCAAATTTA TTTTAAAGTA CAGTTATTTA GGCACGTTCC
TTCTTTTTTG ATCTCTTGGT TTGTTCGCGT ATTCTCTGGG ATCTTGGTTA AATTATACTA TTGTGTTTTT CGTCGATCTT
ATGCAACATA TTTGGTCTTG CAGTTGCCGC AGCCTCTGAT GGTGTGAAAG CGTGGGACAT ACTAAAGGAA AAATCTTTCA
ATATAGACCT TGTTTTAACT GAAGTTGAAC TTCCCTTGAT GTCTGGGTTC CTGCTGCTCT CCACGATCAT GGAACATGAC
GCATGCAAGA ATATCCCCGT CATAAGTATG TATCCAACTT GACTCTATGC CATGCCTTTC TCATATCTTT CTAATCCCAT
TACTCCATCT GATGCTTCAT TTTTCTATTG GTCTCAGTGA TGTCTTCAAA TGATTCCGTT AGCATGGTTT TCAAATGCAT
GCTAAAGGGT GCTGCAGATT TCCTTGTTAA GCCAATACGG AAGAATGAAT TAAGGAACTT ATGGCAGCAT GTTTGGAGAA
AACAACTGGT AAGATCACAT ATTTGCAACG TTTTAGCATG ACTACATTTG CTTTCTCGTT TTTATATATT AAAATTTGGA
TTCTGCATTT TTCACAAAAC TAATCAACAA ACTTCAATTA CTCTGTTTTA CAGTCCAGCG GTGTTCTTGA TGTGCAGCAT
ACTCAACAAG AAGATAATCT TACAGAAAGG CATGAGCAGA AGACCGGAGT GACGAAAGCT GAACATGTGA CTGAAAATGT
TGTCCACAAG AACATGGAAT GCAGTGAACA AGAAAGTGAT GCTCAAGTAA GTTTTAGAAT CAGTTAACAT GACGTTGTCT
ACCTGTTCTT TCTTCTTCCT GCTCATGTGT GCCCAAAGAT AGTCTTGCGT ACAAAATTTC AATCATTAGC CACGTATGGG
ATTTGTGCTG TATCATTTTG CATTGCCCAG CTATGACCGA ACTGTAACAC TTCCATCACC TGATGTTTTG GCCAAAAGCA
GTTTCATTAC CCACACGATA AAAATGGTAT TACTTCATGC AAAAGATGTA TTTAGCCCTT CAGATCTGCA TCAATGTTGG
TGAACTAATT TATCAATTTT TCAAGTCAGG TGGGTAATGG AACTGTGTTT TGAGTGAGAA TAGTATTTTC TTGTCAGCGA
AATGTCACAG TTCGGTCCTC TTGGGTATTG CAAAATGGAG TACATATGAC AACAGTAAGG TAAGTTTTTT TGGCTGCTTG
CAGGATCAGA ATACGGTCCA CACGAACAGT TTGATAAAGC CTATTACGGA ATACTTGTTT GTTTCAAGTA CTGGATATTT
GATGTTACAC ACTTGAACTG AATCTGTAGC ATGTTATTGT CTTCAAGACA TCATACTGCA TAGTCTTTAT ATCCTTAGCA
GTAGGGACTG TCGTTATTAT GCTGAGTTCA GATCTGTTCG CTGTTGTTCG TGGACTGAAT TTTGGATCCC CTCTTGCAGA
GTTCATGTAC AAGGTCAGAA CTGGAGGCTG ACAGTAGGCA AACCAACAAT TTACTGGAAT ATAAGCAGCC AATGGGAAGG
CATTTCTCCA AGCCTGACCA CAAGAACACC GAGAAAAATG GAGGGACTAA AATTCATGGT AATAAAACAT CCTTCATTCT
TTTCTCTGTT ATTTCCATAT CATTCTTCTA CACTGAAAGT GGTCATATCA TCAATTATCT TTTGAATGCA TTTTTTTTCC
TGATATTACC TCCTCCTCGT TTTGCAGCAT CTAATGATGG CAACTTGATT CCACGGAGGG AAGAGGATGC ATCACTGAGG
AGGATGACAT GTTCAAATGA TATTAATTGT GAGAAAGCTT CCAGGGATAT GGAGCTGGTT CATATTATTG ACAATCAGCA
GAAGAATAAC ACACATATGG AGATGGATGT TGCGAGAGCA AATTCCCGTG GAAATGATGA CAAGTGCTTT TCCATTCCAG
CACACCAGTT AGAACTTTCT CTCAGAAGAT CTGACTACAG TAGATTAGAG AGCCAGGAGA AAAATGAACG AAGAACACTG
AACCACTCAA CTTCATCTCC ATTTTCCTTG TAAGTGTTTC TTACTGTAAC GTTTATTCTG TCATTCCTAA TTTGTGCATG
GTTGTTATGT TCGCGTTGAT GTATTTTTCC TACTGGTATA ACAGAAAAAA AATATCGTCT TTGATATTTC ATCATTTATT
TACCTACCAT CATGCGTAGA CATATTTTAC TTTGATTTGC TACAGTATGG TCTTGCAAGC ATAGAATAAA ACATGAAATA
ATATGGAAGT AGCAGAAATT TTTGTATGAT CTCTCTTTTT GTGCATTTAG ATAATCTAAC TTACTGGTTA ACTTGCTCCT
TTACACAGTT TTACCAAGAG CCAACATATG AGATCTCACA CTTCCGATCA TTTCTTGTTC ATAGGTACAA CTGCAGGACA
GCATCATCTA CCATTAATGC TGGTGATGCT CAGGCATGCA GCACCTCGGC AACACATATA GATCTTGAAA ACAAAAATGG
AGATTCCAAA ACTCCCTCTC AAGACAAGAG GGAAACAAAC CAACCTCCCA TTAGAGTTGT ACCATTTCCT GTTCCTGTTG
GAGGACTAAC ATTTGATGGG CAGCCATTCT GGAACGGTGC ACCTGTGGCA TCCCTTTTCT ATCCACAATC AGCTCCTCCC
ATTTGGAATA GCAAAACATC TACCTGGCAA GACGCAACCA CACAAGCAAT TTCTCTGCAG CAGAATGGTC CAAAAGATAC
GGATACTAAG CAGGTTGAAA ATGTAGAGGA ACAAACTGCT CGGAGTCATC TAAGTGCTAA TCGGAAACAT CTCCGCATTG
AAATTCCTAC AGATGAGCCG CGGCATGTTT CTCCAACCAC CGGTGAAAGT GGGAGCAGCA CTGTGCTGGA CAGCGCCAGA
AAAACGCTCA GTGGCAGTGT CTGTGACAGC TCTTCCAACC ACATGATTGC CCCTACTGAA TCATCAAATG TTGTTCCTGA
AAATCCTGAT GGTTTACGCC ACCTGAGCCA ACGAGAGGCT GCACTGAACA AGTTCCGGCT TAAGAGGAAA GACAGGTGCT
TTGAGAAGAA GGTAGGTCAC AAGCAACTAA TCTTGCCATT TTATTCCAAT CCAATTTGTT GTATTGCTGA ATAGTAGAAA
CTGTGGTTTA CATTTTTACA TTGCTGTGCA GGTGCGATAC CAGAGCAGGA AGCTACTAGC CGAGCAGCGA CCGCGGGTTA
AGGGTCAGTT TGTTCGGCAA GATCATGGTG TCCAAGGGAG CTAGGGCTGT CCAAACTTCA GGAGATTGCT GTGCCACGGT
TATCCTGGTG GTCAGTGTCA GATTTTGTTT GAAGAGTGAA AGTATGATTG CCCTGACCTA CAGTCAGCAG TGTATGGTGG
TGTTGCATAT ATATACAGGC TAACTTCGTG TGCTAGGTTA GGCCATGGAC CTCGTACATT GTAGAGTTTG TCAGTAGGGA
TCATATTTTG CTTCAGATCT AGATAAGCTG CGTTTATCAT GTAGCACACG TATTTATGTT TTCTAAATTG TATCTAGCCA
ACAGTTAACG TGTAAGCTGG ACGTGTGTGG ATGTAAGGTG TCAAGGATAT CCAAAGACAA AGTTCTTTTG TACAGTTTCT
TACACTGAAC ATCGTTGGTG TAGTTTCATA CTTTC

Locus: Os09g0532400

Loading...

Locus: Os09g0532400

Loading...