Os09t0532400-02

Locus

Os09g0532400

Description

Signal transduction response regulator, receiver region domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PRR95

CGSNL Gene Name

PSEUDO-RESPONSE REGULATOR 95

Oryzabase Gene Symbol Synonym(s)

OsPRR95, Os-PRR95, Prr2, OsPRR2, OsCCT33

Oryzabase Gene Name Synonym(s)

pseudo-response regulator 2, CCT domain-containing gene 33, CCT (CO, CO-LIKE and TOC1) domain protein 33, CCT domain protein 33

Transcript Evidence

AK067314 (DDBJ, Best hit)

Protein Evidence

Q689G6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CCT domain (IPR010402)

CheY-like superfamily (IPR011006)

Full-length cDNA

J013102G21 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0532400-02)

RiceXPro (AK067314)

Others

Oryzabase (8821)

KEGG (Os09t0532400-02)

Transcript

2334 bp

>Os09t0532400-02 Signal transduction response regulator, receiver region domain containing protein.
GCGACTCCGGCGAGGAGGGGCGAGGGGCGGAGCTAGCGGCGGGGGAATGGGGGGTGGAGT
GGAGGAGAGGAAGGTGGTGGACTTGGAGGACGGGGACGGGGAGGAAGGGGAGGATGCGGC
GGCGGTGGCGGCGGGGTCGAGCAGGGAGACGCGGATGCTGCCGAGGATGCCGGTGCGGGT
GCTGCTCGCTGAGGGCGACGACTCCACGCGCCACATCATCTGCGCGCTGCTCCGCAAGTG
CGGGTATCGAGTTGCCGCAGCCTCTGATGGTGTGAAAGCGTGGGACATACTAAAGGAAAA
ATCTTTCAATATAGACCTTGTTTTAACTGAAGTTGAACTTCCCTTGATGTCTGGGTTCCT
GCTGCTCTCCACGATCATGGAACATGACGCATGCAAGAATATCCCCGTCATAATGATGTC
TTCAAATGATTCCGTTAGCATGGTTTTCAAATGCATGCTAAAGGGTGCTGCAGATTTCCT
TGTTAAGCCAATACGGAAGAATGAATTAAGGAACTTATGGCAGCATGTTTGGAGAAAACA
ACTGTCCAGCGGTGTTCTTGATGTGCAGCATACTCAACAAGAAGATAATCTTACAGAAAG
GCATGAGCAGAAGACCGGAGTGACGAAAGCTGAACATGTGACTGAAAATGTTGTCCACAA
GAACATGGAATGCAGTGAACAAGAAAGTGATGCTCAAAGTTCATGTACAAGGTCAGAACT
GGAGGCTGACAGTAGGCAAACCAACAATTTACTGGAATATAAGCAGCCAATGGGAAGGCA
TTTCTCCAAGCCTGACCACAAGAACACCGAGAAAAATGGAGGGACTAAAATTCATGCATC
TAATGATGGCAACTTGATTCCACGGAGGGAAGAGGATGCATCACTGAGGAGGATGACATG
TTCAAATGATATTAATTGTGAGAAAGCTTCCAGGGATATGGAGCTGGTTCATATTATTGA
CAATCAGCAGAAGAATAACACACATATGGAGATGGATGTTGCGAGAGCAAATTCCCGTGG
AAATGATGACAAGTGCTTTTCCATTCCAGCACACCAGTTAGAACTTTCTCTCAGAAGATC
TGACTACAGTAGATTAGAGAGCCAGGAGAAAAATGAACGAAGAACACTGAACCACTCAAC
TTCATCTCCATTTTCCTTGTACAACTGCAGGACAGCATCATCTACCATTAATGCTGGTGA
TGCTCAGGCATGCAGCACCTCGGCAACACATATAGATCTTGAAAACAAAAATGGAGATTC
CAAAACTCCCTCTCAAGACAAGAGGGAAACAAACCAACCTCCCATTAGAGTTGTACCATT
TCCTGTTCCTGTTGGAGGACTAACATTTGATGGGCAGCCATTCTGGAACGGTGCACCTGT
GGCATCCCTTTTCTATCCACAATCAGCTCCTCCCATTTGGAATAGCAAAACATCTACCTG
GCAAGACGCAACCACACAAGCAATTTCTCTGCAGCAGAATGGTCCAAAAGATACGGATAC
TAAGCAGGTTGAAAATGTAGAGGAACAAACTGCTCGGAGTCATCTAAGTGCTAATCGGAA
ACATCTCCGCATTGAAATTCCTACAGATGAGCCGCGGCATGTTTCTCCAACCACCGGTGA
AAGTGGGAGCAGCACTGTGCTGGACAGCGCCAGAAAAACGCTCAGTGGCAGTGTCTGTGA
CAGCTCTTCCAACCACATGATTGCCCCTACTGAATCATCAAATGTTGTTCCTGAAAATCC
TGATGGTTTACGCCACCTGAGCCAACGAGAGGCTGCACTGAACAAGTTCCGGCTTAAGAG
GAAAGACAGGTGCTTTGAGAAGAAGGTGCGATACCAGAGCAGGAAGCTACTAGCCGAGCA
GCGACCGCGGGTTAAGGGTCAGTTTGTTCGGCAAGATCATGGTGTCCAAGGGAGCTAGGG
CTGTCCAAACTTCAGGAGATTGCTGTGCCACGGTTATCCTGGTGGTCAGTGTCAGATTTT
GTTTGAAGAGTGAAAGTATGATTGCCCTGACCTACAGTCAGCAGTGTATGGTGGTGTTGC
ATATATATACAGGCTAACTTCGTGTGCTAGGTTAGGCCATGGACCTCGTACATTGTAGAG
TTTGTCAGTAGGGATCATATTTTGCTTCAGATCTAGATAAGCTGCGTTTATCATGTAGCA
CACGTATTTATGTTTTCTAAATTGTATCTAGCCAACAGTTAACGTGTAAGCTGGACGTGT
GTGGATGTAAGGTGTCAAGGATATCCAAAGACAAAGTTCTTTTGTACAGTTTCTTACACT
GAACATCGTTGGTGTAGTTTCATACTTTCAGTAAAGCTTGTGATGCTTCCGAAG

CDS

1872 bp

>Os09t0532400-02 Signal transduction response regulator, receiver region domain containing protein.
ATGGGGGGTGGAGTGGAGGAGAGGAAGGTGGTGGACTTGGAGGACGGGGACGGGGAGGAA
GGGGAGGATGCGGCGGCGGTGGCGGCGGGGTCGAGCAGGGAGACGCGGATGCTGCCGAGG
ATGCCGGTGCGGGTGCTGCTCGCTGAGGGCGACGACTCCACGCGCCACATCATCTGCGCG
CTGCTCCGCAAGTGCGGGTATCGAGTTGCCGCAGCCTCTGATGGTGTGAAAGCGTGGGAC
ATACTAAAGGAAAAATCTTTCAATATAGACCTTGTTTTAACTGAAGTTGAACTTCCCTTG
ATGTCTGGGTTCCTGCTGCTCTCCACGATCATGGAACATGACGCATGCAAGAATATCCCC
GTCATAATGATGTCTTCAAATGATTCCGTTAGCATGGTTTTCAAATGCATGCTAAAGGGT
GCTGCAGATTTCCTTGTTAAGCCAATACGGAAGAATGAATTAAGGAACTTATGGCAGCAT
GTTTGGAGAAAACAACTGTCCAGCGGTGTTCTTGATGTGCAGCATACTCAACAAGAAGAT
AATCTTACAGAAAGGCATGAGCAGAAGACCGGAGTGACGAAAGCTGAACATGTGACTGAA
AATGTTGTCCACAAGAACATGGAATGCAGTGAACAAGAAAGTGATGCTCAAAGTTCATGT
ACAAGGTCAGAACTGGAGGCTGACAGTAGGCAAACCAACAATTTACTGGAATATAAGCAG
CCAATGGGAAGGCATTTCTCCAAGCCTGACCACAAGAACACCGAGAAAAATGGAGGGACT
AAAATTCATGCATCTAATGATGGCAACTTGATTCCACGGAGGGAAGAGGATGCATCACTG
AGGAGGATGACATGTTCAAATGATATTAATTGTGAGAAAGCTTCCAGGGATATGGAGCTG
GTTCATATTATTGACAATCAGCAGAAGAATAACACACATATGGAGATGGATGTTGCGAGA
GCAAATTCCCGTGGAAATGATGACAAGTGCTTTTCCATTCCAGCACACCAGTTAGAACTT
TCTCTCAGAAGATCTGACTACAGTAGATTAGAGAGCCAGGAGAAAAATGAACGAAGAACA
CTGAACCACTCAACTTCATCTCCATTTTCCTTGTACAACTGCAGGACAGCATCATCTACC
ATTAATGCTGGTGATGCTCAGGCATGCAGCACCTCGGCAACACATATAGATCTTGAAAAC
AAAAATGGAGATTCCAAAACTCCCTCTCAAGACAAGAGGGAAACAAACCAACCTCCCATT
AGAGTTGTACCATTTCCTGTTCCTGTTGGAGGACTAACATTTGATGGGCAGCCATTCTGG
AACGGTGCACCTGTGGCATCCCTTTTCTATCCACAATCAGCTCCTCCCATTTGGAATAGC
AAAACATCTACCTGGCAAGACGCAACCACACAAGCAATTTCTCTGCAGCAGAATGGTCCA
AAAGATACGGATACTAAGCAGGTTGAAAATGTAGAGGAACAAACTGCTCGGAGTCATCTA
AGTGCTAATCGGAAACATCTCCGCATTGAAATTCCTACAGATGAGCCGCGGCATGTTTCT
CCAACCACCGGTGAAAGTGGGAGCAGCACTGTGCTGGACAGCGCCAGAAAAACGCTCAGT
GGCAGTGTCTGTGACAGCTCTTCCAACCACATGATTGCCCCTACTGAATCATCAAATGTT
GTTCCTGAAAATCCTGATGGTTTACGCCACCTGAGCCAACGAGAGGCTGCACTGAACAAG
TTCCGGCTTAAGAGGAAAGACAGGTGCTTTGAGAAGAAGGTGCGATACCAGAGCAGGAAG
CTACTAGCCGAGCAGCGACCGCGGGTTAAGGGTCAGTTTGTTCGGCAAGATCATGGTGTC
CAAGGGAGCTAG

Protein

624 aa

>Os09t0532400-02 Signal transduction response regulator, receiver region domain containing protein.
MGGGVEERKVVDLEDGDGEEGEDAAAVAAGSSRETRMLPRMPVRVLLAEGDDSTRHIICA
LLRKCGYRVAAASDGVKAWDILKEKSFNIDLVLTEVELPLMSGFLLLSTIMEHDACKNIP
VIMMSSNDSVSMVFKCMLKGAADFLVKPIRKNELRNLWQHVWRKQLSSGVLDVQHTQQED
NLTERHEQKTGVTKAEHVTENVVHKNMECSEQESDAQSSCTRSELEADSRQTNNLLEYKQ
PMGRHFSKPDHKNTEKNGGTKIHASNDGNLIPRREEDASLRRMTCSNDINCEKASRDMEL
VHIIDNQQKNNTHMEMDVARANSRGNDDKCFSIPAHQLELSLRRSDYSRLESQEKNERRT
LNHSTSSPFSLYNCRTASSTINAGDAQACSTSATHIDLENKNGDSKTPSQDKRETNQPPI
RVVPFPVPVGGLTFDGQPFWNGAPVASLFYPQSAPPIWNSKTSTWQDATTQAISLQQNGP
KDTDTKQVENVEEQTARSHLSANRKHLRIEIPTDEPRHVSPTTGESGSSTVLDSARKTLS
GSVCDSSSNHMIAPTESSNVVPENPDGLRHLSQREAALNKFRLKRKDRCFEKKVRYQSRK
LLAEQRPRVKGQFVRQDHGVQGS*

5'UTR

chr09:20889658..20889703 (- strand) : 46 bp

CDS

chr09:20889453..20889657 (- strand) : 205 bp

chr09:20888568..20888729 (- strand) : 162 bp

chr09:20888345..20888475 (- strand) : 131 bp

chr09:20888067..20888219 (- strand) : 153 bp

chr09:20887255..20887393 (- strand) : 139 bp

chr09:20886804..20887125 (- strand) : 322 bp

chr09:20885782..20886448 (- strand) : 667 bp

chr09:20885589..20885681 (- strand) : 93 bp

3'UTR

chr09:20885173..20885588 (- strand) : 416 bp

FASTA

>Os09t0532400-02 class=Sequence position=chr09:20885173..20889703 (- strand)
GCGACTCCGG CGAGGAGGGG CGAGGGGCGG AGCTAGCGGC GGGGGAATGG GGGGTGGAGT GGAGGAGAGG AAGGTGGTGG
ACTTGGAGGA CGGGGACGGG GAGGAAGGGG AGGATGCGGC GGCGGTGGCG GCGGGGTCGA GCAGGGAGAC GCGGATGCTG
CCGAGGATGC CGGTGCGGGT GCTGCTCGCT GAGGGCGACG ACTCCACGCG CCACATCATC TGCGCGCTGC TCCGCAAGTG
CGGGTATCGA GGTGAGCGTC TGTGCCGCAC AGTTTGTTTT TGATCCGGTT AAATTGGTTG ACTGCTTTTG TTCATTGTTT
TTTGCTCGAA TTGTTGTCAC GAGTGGCTAA TCTCACTAGT GAAGTTGCAA AGTTGCGGAT GTTTCTGCGC TGTAAAACTG
TTACTACGTG GCAGCTGATT TTACTGGATT AGACCTCAAG TGGGGAGATT TGGGATGTGA CGATTTGTGA TCTGTTTTTT
TTTTCAGAAG ATATGTTAAT CAATATGCTG ATTTTGGTCT GTAGTTGTAA TTCCTTGCTA TCTGTCTCTT TTTCTTTATT
TTGCCAGAGC TGCTTCAGTA GACGAAATTT GGTGTAGTGC AGCCTATTCG TCAGGAATAC CTAAGTTGAG GCATTACCGA
ATATCATTTT TTTTTCGAAA AAAATATAGC TGTATTTTAA CGATCCATTT CGTATCTTGT GTTAAATTGA AATAACTACA
CATGTATATT TGTTTTTTTC CTGAAGCAAA ATGTTTACCT GTATATTTGA TCCTTTTTTG GGACAGAGTT AGAGCTGAAA
AATGCAGTTT CCTCTTTTAA AACAAAAAAA AAGCAAATTT ATTTTAAAGT ACAGTTATTT AGGCACGTTC CTTCTTTTTT
GATCTCTTGG TTTGTTCGCG TATTCTCTGG GATCTTGGTT AAATTATACT ATTGTGTTTT TCGTCGATCT TATGCAACAT
ATTTGGTCTT GCAGTTGCCG CAGCCTCTGA TGGTGTGAAA GCGTGGGACA TACTAAAGGA AAAATCTTTC AATATAGACC
TTGTTTTAAC TGAAGTTGAA CTTCCCTTGA TGTCTGGGTT CCTGCTGCTC TCCACGATCA TGGAACATGA CGCATGCAAG
AATATCCCCG TCATAAGTAT GTATCCAACT TGACTCTATG CCATGCCTTT CTCATATCTT TCTAATCCCA TTACTCCATC
TGATGCTTCA TTTTTCTATT GGTCTCAGTG ATGTCTTCAA ATGATTCCGT TAGCATGGTT TTCAAATGCA TGCTAAAGGG
TGCTGCAGAT TTCCTTGTTA AGCCAATACG GAAGAATGAA TTAAGGAACT TATGGCAGCA TGTTTGGAGA AAACAACTGG
TAAGATCACA TATTTGCAAC GTTTTAGCAT GACTACATTT GCTTTCTCGT TTTTATATAT TAAAATTTGG ATTCTGCATT
TTTCACAAAA CTAATCAACA AACTTCAATT ACTCTGTTTT ACAGTCCAGC GGTGTTCTTG ATGTGCAGCA TACTCAACAA
GAAGATAATC TTACAGAAAG GCATGAGCAG AAGACCGGAG TGACGAAAGC TGAACATGTG ACTGAAAATG TTGTCCACAA
GAACATGGAA TGCAGTGAAC AAGAAAGTGA TGCTCAAGTA AGTTTTAGAA TCAGTTAACA TGACGTTGTC TACCTGTTCT
TTCTTCTTCC TGCTCATGTG TGCCCAAAGA TAGTCTTGCG TACAAAATTT CAATCATTAG CCACGTATGG GATTTGTGCT
GTATCATTTT GCATTGCCCA GCTATGACCG AACTGTAACA CTTCCATCAC CTGATGTTTT GGCCAAAAGC AGTTTCATTA
CCCACACGAT AAAAATGGTA TTACTTCATG CAAAAGATGT ATTTAGCCCT TCAGATCTGC ATCAATGTTG GTGAACTAAT
TTATCAATTT TTCAAGTCAG GTGGGTAATG GAACTGTGTT TTGAGTGAGA ATAGTATTTT CTTGTCAGCG AAATGTCACA
GTTCGGTCCT CTTGGGTATT GCAAAATGGA GTACATATGA CAACAGTAAG GTAAGTTTTT TTGGCTGCTT GCAGGATCAG
AATACGGTCC ACACGAACAG TTTGATAAAG CCTATTACGG AATACTTGTT TGTTTCAAGT ACTGGATATT TGATGTTACA
CACTTGAACT GAATCTGTAG CATGTTATTG TCTTCAAGAC ATCATACTGC ATAGTCTTTA TATCCTTAGC AGTAGGGACT
GTCGTTATTA TGCTGAGTTC AGATCTGTTC GCTGTTGTTC GTGGACTGAA TTTTGGATCC CCTCTTGCAG AGTTCATGTA
CAAGGTCAGA ACTGGAGGCT GACAGTAGGC AAACCAACAA TTTACTGGAA TATAAGCAGC CAATGGGAAG GCATTTCTCC
AAGCCTGACC ACAAGAACAC CGAGAAAAAT GGAGGGACTA AAATTCATGG TAATAAAACA TCCTTCATTC TTTTCTCTGT
TATTTCCATA TCATTCTTCT ACACTGAAAG TGGTCATATC ATCAATTATC TTTTGAATGC ATTTTTTTTC CTGATATTAC
CTCCTCCTCG TTTTGCAGCA TCTAATGATG GCAACTTGAT TCCACGGAGG GAAGAGGATG CATCACTGAG GAGGATGACA
TGTTCAAATG ATATTAATTG TGAGAAAGCT TCCAGGGATA TGGAGCTGGT TCATATTATT GACAATCAGC AGAAGAATAA
CACACATATG GAGATGGATG TTGCGAGAGC AAATTCCCGT GGAAATGATG ACAAGTGCTT TTCCATTCCA GCACACCAGT
TAGAACTTTC TCTCAGAAGA TCTGACTACA GTAGATTAGA GAGCCAGGAG AAAAATGAAC GAAGAACACT GAACCACTCA
ACTTCATCTC CATTTTCCTT GTAAGTGTTT CTTACTGTAA CGTTTATTCT GTCATTCCTA ATTTGTGCAT GGTTGTTATG
TTCGCGTTGA TGTATTTTTC CTACTGGTAT AACAGAAAAA AAATATCGTC TTTGATATTT CATCATTTAT TTACCTACCA
TCATGCGTAG ACATATTTTA CTTTGATTTG CTACAGTATG GTCTTGCAAG CATAGAATAA AACATGAAAT AATATGGAAG
TAGCAGAAAT TTTTGTATGA TCTCTCTTTT TGTGCATTTA GATAATCTAA CTTACTGGTT AACTTGCTCC TTTACACAGT
TTTACCAAGA GCCAACATAT GAGATCTCAC ACTTCCGATC ATTTCTTGTT CATAGGTACA ACTGCAGGAC AGCATCATCT
ACCATTAATG CTGGTGATGC TCAGGCATGC AGCACCTCGG CAACACATAT AGATCTTGAA AACAAAAATG GAGATTCCAA
AACTCCCTCT CAAGACAAGA GGGAAACAAA CCAACCTCCC ATTAGAGTTG TACCATTTCC TGTTCCTGTT GGAGGACTAA
CATTTGATGG GCAGCCATTC TGGAACGGTG CACCTGTGGC ATCCCTTTTC TATCCACAAT CAGCTCCTCC CATTTGGAAT
AGCAAAACAT CTACCTGGCA AGACGCAACC ACACAAGCAA TTTCTCTGCA GCAGAATGGT CCAAAAGATA CGGATACTAA
GCAGGTTGAA AATGTAGAGG AACAAACTGC TCGGAGTCAT CTAAGTGCTA ATCGGAAACA TCTCCGCATT GAAATTCCTA
CAGATGAGCC GCGGCATGTT TCTCCAACCA CCGGTGAAAG TGGGAGCAGC ACTGTGCTGG ACAGCGCCAG AAAAACGCTC
AGTGGCAGTG TCTGTGACAG CTCTTCCAAC CACATGATTG CCCCTACTGA ATCATCAAAT GTTGTTCCTG AAAATCCTGA
TGGTTTACGC CACCTGAGCC AACGAGAGGC TGCACTGAAC AAGTTCCGGC TTAAGAGGAA AGACAGGTGC TTTGAGAAGA
AGGTAGGTCA CAAGCAACTA ATCTTGCCAT TTTATTCCAA TCCAATTTGT TGTATTGCTG AATAGTAGAA ACTGTGGTTT
ACATTTTTAC ATTGCTGTGC AGGTGCGATA CCAGAGCAGG AAGCTACTAG CCGAGCAGCG ACCGCGGGTT AAGGGTCAGT
TTGTTCGGCA AGATCATGGT GTCCAAGGGA GCTAGGGCTG TCCAAACTTC AGGAGATTGC TGTGCCACGG TTATCCTGGT
GGTCAGTGTC AGATTTTGTT TGAAGAGTGA AAGTATGATT GCCCTGACCT ACAGTCAGCA GTGTATGGTG GTGTTGCATA
TATATACAGG CTAACTTCGT GTGCTAGGTT AGGCCATGGA CCTCGTACAT TGTAGAGTTT GTCAGTAGGG ATCATATTTT
GCTTCAGATC TAGATAAGCT GCGTTTATCA TGTAGCACAC GTATTTATGT TTTCTAAATT GTATCTAGCC AACAGTTAAC
GTGTAAGCTG GACGTGTGTG GATGTAAGGT GTCAAGGATA TCCAAAGACA AAGTTCTTTT GTACAGTTTC TTACACTGAA
CATCGTTGGT GTAGTTTCAT ACTTTCAGTA AAGCTTGTGA TGCTTCCGAA G

Locus: Os09g0532400

Loading...

Locus: Os09g0532400

Loading...