Os09t0533400-01

Locus

Os09g0533400

Description

Similar to Lon protease homolog.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLon1, LON1, OsLonP4, LONP4, LON2

Oryzabase Gene Name Synonym(s)

Lon protease 1, Lon protease 4, LON PROTEASE 2

Transcript Evidence

AK119169 (DDBJ, Best hit)

AK061670 (DDBJ, Best hit)

Protein Evidence

B8BDV1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: ATP-dependent peptidase activity (GO:0004176)

Molecular Function: serine-type endopeptidase activity (GO:0004252)

Functional domain (InterPro)

Peptidase S16, active site (IPR008268)

Peptidase S16, Lon C-terminal (IPR008269)

Ribosomal protein S5 domain 2-type fold (IPR020568)

Full-length cDNA

001-036-G01 (Online Clone Ordering)

001-036-G02 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0533400-01)

RiceXPro (AK119169)

Others

Oryzabase (14677)

KEGG (Os09t0533400-01 (EC:3.4.21.53))

Transcript

1299 bp

>Os09t0533400-01 Similar to Lon protease homolog.
GAGATACACGCGAGAAGCTGGTGTACGTAATCTTGAGCGGAACCTAGCTGCATTGGCCCG
TGCAGCTGCAGTCAAGGTTGCGGAGCAAGATAGTGCGCTTAGACTTGGCAAGGAAATACA
ACCAATTACTACAACTCTACTGGATTCTAGGCTTGCTGATGGTGGTGAAGTTGAAATGGA
AGTTATTCCTATGGGCCAGGACATATCAAATACTTATGAGAATCCATCACCCATGATTGT
TGATGAGGCTATGCTAGAAAAAGTGCTTGGGCCTCCAAGATTTGATGATAGCGAAGCTGC
AGATCGTGTGGCGAGCCCAGGAGTGTCAGTTGGGCTTGTTTGGACTTCATTTGGTGGGGA
GGTACAATTTGTCGAGGCTACAGCGATGGTGGGTAAGGGTGATTTGCATCTGACAGGGCA
ACTTGGTGACGTAATTAAGGAGTCAGCACAGTTAGCTCTGACATGGGTGAGAGCAAGAGC
TGCTGACCTTAATCTGTCACCTACTTCTGATATTAACTTATTGGAGAGTCGTGATATTCA
CATACATTTTCCTGCTGGCGCGGTGCCAAAGGATGGTCCTTCTGCTGGAGTGACATTGGT
AACATCATTAGTGTCACTATTTAGCCACCGAAAAGTCAGAGCTGACACTGCTATGACGGG
AGAGATGACTCTTAGGGGCCTTGTGTTGCCAGTTGGCGGTGTTAAGGATAAGGTACTTGC
AGCACATAGATATGGCATCAAGAGAGTAATATTGCCAGAAAGAAACATGAAGGACTTGGC
TGAGGTTCCAGCACCCATTCTCTCTGGCTTGGAGATTCTGCTTGTGAAGCGCATCGAGGA
AGTACTTGACCATGCTTTTGAAGGTGGATGCCCTCTGAGACCACACTCCAAGCTATAGCA
TCAACCAATCTGAAGATGGCGTTTGATCTGGTATACTTTCCTGCTGGTTATGTACCTATT
TTGGAGATTCATCCATAAAACAAGGTTCAGATTTCCATGAAAGAGCAACTATTCCACGAG
GTAGAATCTCACGCCAAACGCAGGCTTGCAGCGCTGCTGCCAATCCATCTCGGTTGAGCA
ACATTCGGAATCTGTATACGAGTTATACAAAACAGATGTGAGTTCTGCACTTCTGTTTGT
GCCTGCGTTCCCAACTGCATATATTTATAGAGGGATACTGTCTGATGTACACGCATCTGT
TGTTGATTTGGCTGTATATGTAATCTATTTAGGGAAAAATCAATATGTCATATCATACCA
CAAGAAGGAATCATCAAAGAGCCCTCGAGGCTGTTCCTC

CDS

897 bp

>Os09t0533400-01 Similar to Lon protease homolog.
AGATACACGCGAGAAGCTGGTGTACGTAATCTTGAGCGGAACCTAGCTGCATTGGCCCGT
GCAGCTGCAGTCAAGGTTGCGGAGCAAGATAGTGCGCTTAGACTTGGCAAGGAAATACAA
CCAATTACTACAACTCTACTGGATTCTAGGCTTGCTGATGGTGGTGAAGTTGAAATGGAA
GTTATTCCTATGGGCCAGGACATATCAAATACTTATGAGAATCCATCACCCATGATTGTT
GATGAGGCTATGCTAGAAAAAGTGCTTGGGCCTCCAAGATTTGATGATAGCGAAGCTGCA
GATCGTGTGGCGAGCCCAGGAGTGTCAGTTGGGCTTGTTTGGACTTCATTTGGTGGGGAG
GTACAATTTGTCGAGGCTACAGCGATGGTGGGTAAGGGTGATTTGCATCTGACAGGGCAA
CTTGGTGACGTAATTAAGGAGTCAGCACAGTTAGCTCTGACATGGGTGAGAGCAAGAGCT
GCTGACCTTAATCTGTCACCTACTTCTGATATTAACTTATTGGAGAGTCGTGATATTCAC
ATACATTTTCCTGCTGGCGCGGTGCCAAAGGATGGTCCTTCTGCTGGAGTGACATTGGTA
ACATCATTAGTGTCACTATTTAGCCACCGAAAAGTCAGAGCTGACACTGCTATGACGGGA
GAGATGACTCTTAGGGGCCTTGTGTTGCCAGTTGGCGGTGTTAAGGATAAGGTACTTGCA
GCACATAGATATGGCATCAAGAGAGTAATATTGCCAGAAAGAAACATGAAGGACTTGGCT
GAGGTTCCAGCACCCATTCTCTCTGGCTTGGAGATTCTGCTTGTGAAGCGCATCGAGGAA
GTACTTGACCATGCTTTTGAAGGTGGATGCCCTCTGAGACCACACTCCAAGCTATAG

Protein

299 aa

>Os09t0533400-01 Similar to Lon protease homolog.
RYTREAGVRNLERNLAALARAAAVKVAEQDSALRLGKEIQPITTTLLDSRLADGGEVEME
VIPMGQDISNTYENPSPMIVDEAMLEKVLGPPRFDDSEAADRVASPGVSVGLVWTSFGGE
VQFVEATAMVGKGDLHLTGQLGDVIKESAQLALTWVRARAADLNLSPTSDINLLESRDIH
IHFPAGAVPKDGPSAGVTLVTSLVSLFSHRKVRADTAMTGEMTLRGLVLPVGGVKDKVLA
AHRYGIKRVILPERNMKDLAEVPAPILSGLEILLVKRIEEVLDHAFEGGCPLRPHSKL*

5'UTR

chr09:20948006..20948006 (- strand) : 1 bp

CDS

chr09:20947736..20948005 (- strand) : 270 bp

chr09:20947435..20947629 (- strand) : 195 bp

chr09:20946976..20947221 (- strand) : 246 bp

chr09:20946758..20946859 (- strand) : 102 bp

chr09:20946405..20946488 (- strand) : 84 bp

3'UTR

chr09:20946004..20946404 (- strand) : 401 bp

FASTA

>Os09t0533400-01 class=Sequence position=chr09:20946004..20948006 (- strand)
GAGATACACG CGAGAAGCTG GTGTACGTAA TCTTGAGCGG AACCTAGCTG CATTGGCCCG TGCAGCTGCA GTCAAGGTTG
CGGAGCAAGA TAGTGCGCTT AGACTTGGCA AGGAAATACA ACCAATTACT ACAACTCTAC TGGATTCTAG GCTTGCTGAT
GGTGGTGAAG TTGAAATGGA AGTTATTCCT ATGGGCCAGG ACATATCAAA TACTTATGAG AATCCATCAC CCATGATTGT
TGATGAGGCT ATGCTAGAAA AAGTGCTTGG GGTATGCTAT TAAACATTTG AGTATTGAGT ATAGCCTTAT GAGAAGCTAC
AGAGTTCTTT CTTTTTGTTT GTCTTACTTA TGGTAATATG CTATATTTGT GCTACAGCCT CCAAGATTTG ATGATAGCGA
AGCTGCAGAT CGTGTGGCGA GCCCAGGAGT GTCAGTTGGG CTTGTTTGGA CTTCATTTGG TGGGGAGGTA CAATTTGTCG
AGGCTACAGC GATGGTGGGT AAGGGTGATT TGCATCTGAC AGGGCAACTT GGTGACGTAA TTAAGGAGTC AGCACAGTTA
GCTCTGACAT GGGTAAGCAT CTTCTTTAAC TTTCACCTAT CTATGCATTG GTTGCATCAT GCTGCTTTGT TTATTTTCTG
CTGGTTCTCT GATATCGCCC TTTGAAGTTA TTTTTCTCCA ATTATTGTTA CTGGAATGAA ACTCCAATAT TACATAAGAA
GAAAACACAA TGTTTTGGTG CCTAGTTTTG CATAGTGGTA CTCATCATTT CCTTGGTTTT GACAGGTGAG AGCAAGAGCT
GCTGACCTTA ATCTGTCACC TACTTCTGAT ATTAACTTAT TGGAGAGTCG TGATATTCAC ATACATTTTC CTGCTGGCGC
GGTGCCAAAG GATGGTCCTT CTGCTGGAGT GACATTGGTA ACATCATTAG TGTCACTATT TAGCCACCGA AAAGTCAGAG
CTGACACTGC TATGACGGGA GAGATGACTC TTAGGGGCCT TGTGTTGCCA GTTGGCGGTG TTAAGGATAA GGTACTGCCC
TATAGGTTCC TGACATGTTA TTTAATTGAC TTCAGAAGGA TGAAAGCTTA ACCATTTTCT CTGCTCTGCT CTTTGACTAA
CTTGAAATGT TTTTTTCTGG AATTCAGGTA CTTGCAGCAC ATAGATATGG CATCAAGAGA GTAATATTGC CAGAAAGAAA
CATGAAGGAC TTGGCTGAGG TTCCAGCACC CATTCTCTCT GGCTTGGAGG TATGTATTGA GAGCTTTGCT CTATGTATTT
CGACAGTCAG AGATGCTCTA AGGCCCTGAG CATATAGTTG ATATGTATGG TGCACAAATT GTTTCGGAGT TAAAAAATAT
ATCATAGATA AAGTAGCATT GGAAGAAATT TCCGATACCA TATAGTAGAC GTATGTTTTG AATCGTAGAT GACCAGTAAA
TAGAGTTTTC CCTTTTGGGT GCAATGTAGC TGTCTAAAAA ATGTCTATTG CTGACTTTAC TTCGACCTGC TACTGTAGAT
TCTGCTTGTG AAGCGCATCG AGGAAGTACT TGACCATGCT TTTGAAGGTG GATGCCCTCT GAGACCACAC TCCAAGCTAT
AGCATCAACC AATCTGAAGA TGGCGTTTGA TCTGGTATAC TTTCCTGCTG GTTATGTACC TATTTTGGAG ATTCATCCAT
AAAACAAGGT TCAGATTTCC ATGAAAGAGC AACTATTCCA CGAGGTAGAA TCTCACGCCA AACGCAGGCT TGCAGCGCTG
CTGCCAATCC ATCTCGGTTG AGCAACATTC GGAATCTGTA TACGAGTTAT ACAAAACAGA TGTGAGTTCT GCACTTCTGT
TTGTGCCTGC GTTCCCAACT GCATATATTT ATAGAGGGAT ACTGTCTGAT GTACACGCAT CTGTTGTTGA TTTGGCTGTA
TATGTAATCT ATTTAGGGAA AAATCAATAT GTCATATCAT ACCACAAGAA GGAATCATCA AAGAGCCCTC GAGGCTGTTC
CTC

Locus: Os09g0533400

Loading...

Locus: Os09g0533400

Loading...