Os09t0533600-01

Locus

Os09g0533600

Description

Receptor-like cytoplasmic kinase, Resistance to multiple bacterial and fungal pathogens

RAP-DB Gene Symbol Synonym(s)

BSR1

RAP-DB Gene Name Synonym(s)

Broad-Spectrum Resistance 1

CGSNL Gene Symbol

BSR1

CGSNL Gene Name

BROAD-SPECTRUM RESISTANCE 1

Oryzabase Gene Symbol Synonym(s)

OsRLCK278, RLCK278, PTK15, OsPTK15

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 278, Protein Tyrosine Kinase 15

Transcript Evidence

AK070024

Protein Evidence

Q69SG8

Literature

PMID: 30222251

PMID: 20955180

Note

Manual Curation

December 11, 2018

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase, catalytic domain (IPR001245)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886) [mainly]

cytoplasm (GO:0005737)

Full-length cDNA

J023038G05 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0533600-01)

RiceXPro (AK070024)

Others

Oryzabase (8864)

KEGG (Os09t0533600-01)

Transcript

1439 bp

>Os09t0533600-01 Receptor-like cytoplasmic kinase, Resistance to multiple bacterial and fungal pathogens
GTGCGTGCGTGCGTGCTTGCTTGCTGCAAGAAATGAGCTGCTTGGGTTGGTTCAAGAAGC
GGAGGTCGTCCAAGAGCAAGGAATCGTCGGGGAGGCGGGGCTCGACGACGACGACGGTGT
CGGCGGTGAGCACGAGCAGGTCGGACGACTCCGGGGCGGTGAGGCCGGCGAGCAAGTCGA
CGGGGTCGACGTCGTCGCACCGGAGCATCTCGTCGCTGTACGAGGAGCGCGGCCACGGCC
AGCTCCGGGACTTCGACTACgacgagctccaggccgccaccaacggcttcagccgcgccc
agaagctcggcgagggcggcttcggcagcgtctacAAGGGCTTCGTCCGCTCCTCCCCCG
CCGACGGCAAGGCCGCCGATCGCCTCGCCGTCGCCGTCAAGTGCCTGAACCAGCGGGGTC
TCCAGggacataagcagtggttggcggaagtacagttccttggggttcttgagcacccaa
accttgtaaAGCTTCTTGGATATTGTGCCGTTGATGGTGAAAGGGGGCCACAAAGATTAT
TGGTGTATGAGTATATGCCTAATAAGAGCCTGGAAGATCACTTATTCGTCCGAGCTTATC
CTCCTCTCTCATGGAATAGAAGGCTTCAAATAATCTTGGGTGCTGCAGAAGGATTAGCTT
ACCTGCATGAAGGGCAAGTTCAGGTAATCTACCGGGACTTCAAAGCATCTAACATTTTGT
TGGACAAAGACTTCAGAGCAAAGCTGTCGGACTTCGGGCTAGCAAGGGAGGGACCAACAG
GAGCAAACACTCACGTCTCAACAGCGGTGGTTGGGACGCACGGGTACGCGGCGCCGGACT
ACATAGAGACGGGGCACCTGACGGTGAAGAGCGACGTGTGGAGCTTCGGGGTGGTGCTGT
ACGAGATCCTGACGGGGCGGCGGACGCTGGACCGCCACCGGCCGCAGGGGGAGCAGAAGC
TGCTGGAGTGGGTCGCCCAGTTCGCCCCCGACAGCCGCAACTTCCGCATGATCATGGATC
CCAGGCTCCGCGGCGAGTACTCCGTCAAGGCCGCCCGCGACATCGCCAAGCTCGCCGAGT
CCTGCCTCCTCAAGAACGCCAAGGAGCGCCCCACCATGTCCGAGGTCGTCGACGTCCTCC
GCCGCGCCGTCCAGTCGCAGCCCGACCCTCCTCCTCCCCCCGCCGCCGCCGCCGCCGCCT
CCGGCAAGGGGAAGAGGGTCGACGTCGCGCCGCAGCCGGCGAGGAGGAGGTGAGGTTGCA
CTCTGCTGCTATCATCGATCACGGCATGAATGAAGAAAGAAAAGTACAGAAAGAGAGACA
CAGAGACGAGTTGGTGGATTCTTGGCGTTTTTGTTTTTTGTTTTCCTTTCTATTTTTTAG
GCTTATTTAGGATGAGGATAGTAGTATGAGAATACATTTGATTTGATTGGTAGATAACt

CDS

1221 bp

>Os09t0533600-01 Receptor-like cytoplasmic kinase, Resistance to multiple bacterial and fungal pathogens
ATGAGCTGCTTGGGTTGGTTCAAGAAGCGGAGGTCGTCCAAGAGCAAGGAATCGTCGGGG
AGGCGGGGCTCGACGACGACGACGGTGTCGGCGGTGAGCACGAGCAGGTCGGACGACTCC
GGGGCGGTGAGGCCGGCGAGCAAGTCGACGGGGTCGACGTCGTCGCACCGGAGCATCTCG
TCGCTGTACGAGGAGCGCGGCCACGGCCAGCTCCGGGACTTCGACTACgacgagctccag
gccgccaccaacggcttcagccgcgcccagaagctcggcgagggcggcttcggcagcgtc
tacAAGGGCTTCGTCCGCTCCTCCCCCGCCGACGGCAAGGCCGCCGATCGCCTCGCCGTC
GCCGTCAAGTGCCTGAACCAGCGGGGTCTCCAGggacataagcagtggttggcggaagta
cagttccttggggttcttgagcacccaaaccttgtaaAGCTTCTTGGATATTGTGCCGTT
GATGGTGAAAGGGGGCCACAAAGATTATTGGTGTATGAGTATATGCCTAATAAGAGCCTG
GAAGATCACTTATTCGTCCGAGCTTATCCTCCTCTCTCATGGAATAGAAGGCTTCAAATA
ATCTTGGGTGCTGCAGAAGGATTAGCTTACCTGCATGAAGGGCAAGTTCAGGTAATCTAC
CGGGACTTCAAAGCATCTAACATTTTGTTGGACAAAGACTTCAGAGCAAAGCTGTCGGAC
TTCGGGCTAGCAAGGGAGGGACCAACAGGAGCAAACACTCACGTCTCAACAGCGGTGGTT
GGGACGCACGGGTACGCGGCGCCGGACTACATAGAGACGGGGCACCTGACGGTGAAGAGC
GACGTGTGGAGCTTCGGGGTGGTGCTGTACGAGATCCTGACGGGGCGGCGGACGCTGGAC
CGCCACCGGCCGCAGGGGGAGCAGAAGCTGCTGGAGTGGGTCGCCCAGTTCGCCCCCGAC
AGCCGCAACTTCCGCATGATCATGGATCCCAGGCTCCGCGGCGAGTACTCCGTCAAGGCC
GCCCGCGACATCGCCAAGCTCGCCGAGTCCTGCCTCCTCAAGAACGCCAAGGAGCGCCCC
ACCATGTCCGAGGTCGTCGACGTCCTCCGCCGCGCCGTCCAGTCGCAGCCCGACCCTCCT
CCTCCCCCCGCCGCCGCCGCCGCCGCCTCCGGCAAGGGGAAGAGGGTCGACGTCGCGCCG
CAGCCGGCGAGGAGGAGGTGA

Protein

407 aa

>Os09t0533600-01 Receptor-like cytoplasmic kinase, Resistance to multiple bacterial and fungal pathogens
MSCLGWFKKRRSSKSKESSGRRGSTTTTVSAVSTSRSDDSGAVRPASKSTGSTSSHRSIS
SLYEERGHGQLRDFDYDELQAATNGFSRAQKLGEGGFGSVYKGFVRSSPADGKAADRLAV
AVKCLNQRGLQGHKQWLAEVQFLGVLEHPNLVKLLGYCAVDGERGPQRLLVYEYMPNKSL
EDHLFVRAYPPLSWNRRLQIILGAAEGLAYLHEGQVQVIYRDFKASNILLDKDFRAKLSD
FGLAREGPTGANTHVSTAVVGTHGYAAPDYIETGHLTVKSDVWSFGVVLYEILTGRRTLD
RHRPQGEQKLLEWVAQFAPDSRNFRMIMDPRLRGEYSVKAARDIAKLAESCLLKNAKERP
TMSEVVDVLRRAVQSQPDPPPPPAAAAAASGKGKRVDVAPQPARRR*

5'UTR

chr09:20967421..20967452 (- strand) : 32 bp

CDS

chr09:20967028..20967420 (- strand) : 393 bp

chr09:20964906..20965163 (- strand) : 258 bp

chr09:20964095..20964217 (- strand) : 123 bp

chr09:20962453..20962899 (- strand) : 447 bp

3'UTR

chr09:20962267..20962452 (- strand) : 186 bp

FASTA

>Os09t0533600-01 class=Sequence position=chr09:20962267..20967452 (- strand)
GTGCGTGCGT GCGTGCTTGC TTGCTGCAAG AAATGAGCTG CTTGGGTTGG TTCAAGAAGC GGAGGTCGTC CAAGAGCAAG
GAATCGTCGG GGAGGCGGGG CTCGACGACG ACGACGGTGT CGGCGGTGAG CACGAGCAGG TCGGACGACT CCGGGGCGGT
GAGGCCGGCG AGCAAGTCGA CGGGGTCGAC GTCGTCGCAC CGGAGCATCT CGTCGCTGTA CGAGGAGCGC GGCCACGGCC
AGCTCCGGGA CTTCGACTAC gacgagctcc aggccgccac caacggcttc agccgcgccc agaagctcgg cgagggcggc
ttcggcagcg tctacAAGGG CTTCGTCCGC TCCTCCCCCG CCGACGGCAA GGCCGCCGAT CGCCTCGCCG TCGCCGTCAA
GTGCCTGAAC CAGCGGGGTC TCCAGGTACT CGCTTGTTTG CGTGCTCTCC TCCTCCTTCT CGTTCCCCTG TCTCTGTCTC
TCTTTGCAGT CTGCACCCCC TCCTCTTGAC TTTTCTTGGA CACCATCAAT CATGTCTTGT CAGTTGTCAC CCGGGAACGA
ATCCTCCATT CCGATCCAGG AGTAGTATTC CCCCCTTTGT GATTCTGCGC GATTGATTTC CGGTTTGATA ACTAGGGGTG
AATAGGAATT TGGGAATAGG AGAATTGGGG AATGAGTTTT GTTAGTTTAA GGTTTGCTCT CTTATGTTCA GTATTGTCAG
AAATTAGTGC TGGTAGATAA GGGAAGTGTT TTTTTAAGGG AGATCCCAAA TGATGCCATT TTTGTTGTTC TTGATACTTC
TCTTCGCCAA GATCCTGGCA TAGAATGCAG AAGAATGCTT TCAGGCAACT TAGCGAGTTT TTGTTTTTAA TGTGTAGTTC
TGCCAAATTT GATGAAAATC ATCAGTAGTG ACCACTAGAT TAGATTAACG ACTGTTATGG GAAGATTCAT TATGGGGAGT
AAAGTTAATG GATTCTGTGC TTGGTGTTAG CTGATCTTGA ATTGGTCTCT GGATAAACTG ACAAGTATGT TGTTCTGATC
CATAGGAAGT CCATGGACAC AAGTCATTTT CTAGTTTGCC GGAATATTGG AAATATTCCT GGCTTGCTAA ATGTTGAAAT
TGGTTTGGTT ATCTATTATC AGTATGTTAA AAATCTCTCT CTGTGTAGAC AATCTTGACA GGAAGACAGG ATCAAAATGC
AGAACTTTCA AGGATGAGAT ATTGCCTGTT ACTGTTATTT TACAATTTTG ATAGTATATT TTATGGGGTC AATCTATTGC
ATTGGATTAC TTCAGTCCAT TGTCAGTTGA CTATAGAAGT TACTGGTCTG CATAAACTAT TACTAGTTGA GGTGCTGGGC
GTGGAGATGT GGTTAAATAT AGGACCAATG GGCACACGTG GCAACTGTTT ATTCATAATA AAGCAAAATG GAGGGGAAAT
ACAGGATAGA ATTTGAACGG CAATGAACTT TTCAAGTATC TAGGAACCTT ACTTCCTCAA ACTTGGAAGT TGAATATTCA
TTCATGGTCA TCATAAAACA AATGGCAATC AATATTAATA GTAGACCATG TCTTCTCTGA ATGCTTACAG TAGAAATATG
TCTCCTAGAA AATGATGCGA ACCAACCTTT CACTCTAAAT CAATATTCCG TTAGCTAATT TGCTCAATCA AAGAAGACTA
ATGGATAGAA TAGATTACGT TTCTGGGCAA CCTGCACAAC CATGTTGCTA GTCTTATTTG ACTATTATTC ACTCACTAGG
AGGAAAAATT TTGGTGCGTG AACATATAGA ACAAAAGTCA GCTAGAAACT TCAATTTCCA TGTGCTTTGC GACTCTATAT
CCATTCTGAA TTTATGCAAG TGATGTCTAA AGACTGACAA ACCGGTAGTG AATATATCGT TTAGTGGAGT ACAGGAAATA
ATTAATTTCA AGTCCTGAAC TTAATAGAAT ACCCAAGCAT AAGCTTCATT TTCTCTAAGT GGTGTCTGCT AAAAATATAA
GGATTTTTCC AAGTTTCTCT ACTCGAATTA GATGATATTT TACTGACTCA GTTATGATGT CTTTTCTTGA CCAGTTGATG
TATATTAGGA ATTTAGGATG CACGCTAATT ATAGTGATGT TATGAATAAA CTACTTGTAA GGCAGCATTA GGTCTGTTGG
TTTCCTATAT TTGCTTTGTG CTATAATGCT ACTAAAACAA ATGCGGTTGA TCTCCTATGC TATCCCTCTA ATGAGTAATC
CTGTCTTCTG TTCCTAATAT TTTGCAGttt cttttaattt tgctcccagg gacataagca gtggttggcg gaagtacagt
tccttggggt tcttgagcac ccaaaccttg taaAGCTTCT TGGATATTGT GCCGTTGATG GTGAAAGGGG GCCACAAAGA
TTATTGGTGT ATGAGTATAT GCCTAATAAG AGCCTGGAAG ATCACTTATT CGTCCGAGCT TATCCTCCTC TCTCATGGAA
TAGAAGGCTT CAAATAATCT TGGGTGCTGC AGAAGGATTA GCTTACCTGC ATGAAGGGCA AGTTCAGGTA TACTTCAGAC
ATACATTGCC CACATGCTTT CAACTTCTCT GAAAAGATAT ATCTTTATCA AATAGGTGAT TTCGTTTTTT GTGGGAGAAA
GTTTGGCAAT AAAAATATAT GATGAGAGAC AGCACCAACG TTTTAATAGG TTCTTTTGAC CGTGCATCCA TAGTAACTAG
AGGTAGTGCA ATAGAGGTGC AGTGAATCCA GTATTCCAGT GTAAAGTCAA TGAGAAAATA AGGACCACGA ATTGATGAGC
TAGATGAAAA AGAGGCAAAA GTGGTTTGTT CAATTCCATC TCCATCTCCA TTACTTTCCT GTAAGATTCC AGGCACCAAA
TTTCATTGAC ACTTTCTGAA AGCATAATCA GTACTAACTA CTCCTAGTTG CAACCAACGT ATACGATTTG TCCTCTCTAT
GTTCTAGTTT AGCTGTAGAA CCAAGTATTC CAATCTAGAA AACAATTAAG GACTTAGGCA AGAAGGCTCT ATAGCTGGTG
AGCATCAAGA TATACAGGCT GTTAGGGAAG GCTAAACCTA TCACATTTTT TCAGGTCATC GTCATAATTT ACAGTGCTAA
TTGCGTACTG CTGCTTAGTA TACAAAGTTA CTTCAGCTTT TCTTCTTCTT TGGTTACGAC ATTTCCATTT TGTACAAAAG
GGAAGATCCT CATCTGATTT GCTCAATTTT GATAGGTAAT CTACCGGGAC TTCAAAGCAT CTAACATTTT GTTGGACAAA
GACTTCAGAG CAAAGCTGTC GGACTTCGGG CTAGCAAGGG AGGGACCAAC AGGAGCAAAC ACTCACGTCT CAACAGCGGT
ATGTCTCCAT CTGAACCTGC TATTAGAATT ACAAACAAAA CCATAGCCTT CTCGCAACTG CATTGTCTGA TCCATCAGGC
ACTGAAAGCA ACTTATATAC TACAGCCTTT AAAGCATCGT TGACTGAAGT AGGCAAGCAG TCCAGTGCAC CTGTTTGATG
TGTACCTGAC AATCTTGACC GCAATCCAGC AAGTCAATGC CATGGACCAA GTTGCCACCA CTTCCTTACA TATGCACACA
TGCCACGCAT GCATCACTCT TCTCCCCCTG AATTTTGCAC CTTGTGTCAG CATTGACGCA GAACTGCTCT ATGGCATACC
ATACCAGACC TTTGGAACAT AGGAATTTTA GAAGATTTCC ATGAAATTCC TGCATTGCGA AGGAGCTTTG AGCTATGTTA
TTATCCTTAG GAAATGGATC AATGCTATAA TTGTCtgctt attggcttat tagccacaac aaaaaatttg aattctaaaa
cataattcta aagttgattt tgggtctttt catcatagtc tatttagggg ttgtttggat acactgacta aactttagtc
cctgttacat cggatatttg gacactaatt tggagtatta aacatagact acttataaaa ctaattacac aaatagaggc
taattcgcga gacaaatcta tttaagccta attaatccat gattagcaca tatttactgt agcactatat tatcaaatca
tggactaatt aggcttaata tattcgtctc gcaaattaac ctccaccgtg taattagttt tataattagt ttatatttaa
tactctaaat tagtgtccaa acatccgatg taccagggac taaagtttag tcagggtatc caaacacccc cttaATAGCC
TTAGCTTTAA ACCACTAATA ACACACACAT ATATAAAGGT TTTATCTATA AACTATTTGT AGTTGCTTAG TTTTAAATTG
TTTTTTTTTT GTTTTTACCT TCATGTACCC TATTTGATGT CATTTTGGCT TTTGAACGGT TCGCTAAAAA CATGTCTTAT
CCATAAATCG GTCTTAGTTG CTTCGTTTAT TTTTCTTGTC GTAGTCCAAT CGATCAGAGG TTTGAATTTT TCTTTTTCAT
GTTCTTACTA TATGATACAT ACATAGCTGA GCTCAAGATG GTGTATGATG ATGATGATGA TGATGTGTGG CAGGTGGTTG
GGACGCACGG GTACGCGGCG CCGGACTACA TAGAGACGGG GCACCTGACG GTGAAGAGCG ACGTGTGGAG CTTCGGGGTG
GTGCTGTACG AGATCCTGAC GGGGCGGCGG ACGCTGGACC GCCACCGGCC GCAGGGGGAG CAGAAGCTGC TGGAGTGGGT
CGCCCAGTTC GCCCCCGACA GCCGCAACTT CCGCATGATC ATGGATCCCA GGCTCCGCGG CGAGTACTCC GTCAAGGCCG
CCCGCGACAT CGCCAAGCTC GCCGAGTCCT GCCTCCTCAA GAACGCCAAG GAGCGCCCCA CCATGTCCGA GGTCGTCGAC
GTCCTCCGCC GCGCCGTCCA GTCGCAGCCC GACCCTCCTC CTCCCCCCGC CGCCGCCGCC GCCGCCTCCG GCAAGGGGAA
GAGGGTCGAC GTCGCGCCGC AGCCGGCGAG GAGGAGGTGA GGTTGCACTC TGCTGCTATC ATCGATCACG GCATGAATGA
AGAAAGAAAA GTACAGAAAG AGAGACACAG AGACGAGTTG GTGGATTCTT GGCGTTTTTG TTTTTTGTTT TCCTTTCTAT
TTTTTAGGCT TATTTAGGAT GAGGATAGTA GTATGAGAAT ACATTTGATT TGATTGGTAG ATAACt

Locus: Os09g0533600

Loading...

Locus: Os09g0533600

Loading...