Os09t0537600-01

Locus

Os09g0537600

Description

Cyclophilin 21 protein, Peptidyl prolyl cis-trans isomerase (PPIase) activity, Negative regulation of ABA signalling, Regulation of seed germination and seedling growth and development

RAP-DB Gene Symbol Synonym(s)

OsCYP21-1

RAP-DB Gene Name Synonym(s)

cyclophilin 21-1

CGSNL Gene Symbol

CYP21-1

CGSNL Gene Name

CYCLOPHILIN 21-1

Oryzabase Gene Symbol Synonym(s)

OsCYP21-1, OsCYP-24

Oryzabase Gene Name Synonym(s)

cyclophilin 21-1, cyclophilin 24

Transcript Evidence

AK061004

Protein Evidence

Q69JF7

Literature

PMID: 31786704

Note

Manual Curation

December 3, 2019

Gene Ontology (GO)

Biological Process: protein peptidyl-prolyl isomerization (GO:0000413)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Cyclophilin-like domain superfamily (IPR029000)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase (IPR024936)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain (IPR002130)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site (IPR020892)

Experimentally confirmed subcellular location

Golgi cis cisternae (GO:0000137)

Golgi trans cisternae (GO:0000138)

Full-length cDNA

006-203-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0537600-01)

RiceXPro (AK061004)

Others

Oryzabase (10062)

KEGG (Os09t0537600-01 (EC:5.2.1.8))

Transcript

1142 bp

>Os09t0537600-01 Cyclophilin 21 protein, Peptidyl prolyl cis-trans isomerase (PPIase) activity, Negative regulation of ABA signalling, Regulation of seed germination and seedling growth and development
GTCTGCTTCGTCGCCGATCTCGTCTCCGCCGCCCGCGAGCGAATCGCCCCCAAATCGGGA
GGGCGGCTGCTCTCGCCTGCAGATTTGCGCCGTCGTTGCGGCGAATTGATGAGGTAGAAG
TGTCCAACTACTCGCCCCTGGTTCGCGATGCTGCGGAAGGTGGCCGTCGCCTTCCTCGCT
TGCGCCGCCCTCTACCTCGCCTTCGCCGCCTACTCCCGCCGCGAGAGCCTTGGAGAGGTT
CGATTACCTGCAGTTACTAACAGGGTATACTTGGATGTGGAAATTGATGGGCAACATATA
GGTAGAATTGTCATTGGCCTTTATGGAGATGTTGTGCCAAAAACAGTTGCAAATTTTAGG
GCTCTTTGTACAGGAGAAGAGGGCATTGGGCACAAGGGTAAATCTCTTCACTATAAAGGA
TCAAGATTTCATCGTATTATCCCAGGCTTCATGATTCAGGGTGGGGACATAGTTAGAGGT
GATGGAAAAGGAAGTGAGTCTATATATGGGGGCACCTTCCCAGATGAGAATTTCATAGTA
AAACATACACATCCAGGTGTTATTGCCATGGCAAATTCTGGACCTGATTCCAATGGATCG
CAGTTTTACATTACCACAATCAAGACAAGCTGGTTGGATGGGGAGCATGTTGTGTTTGGC
AGGGTGATTCAGGGAATGGATTATGTGTACGCCATTGAAGGGGGTGCTGGAACTTACAAT
GGCAAGCCTAGGAAGAAAGTTGTAATCACCGACTCTGGTGAGATACCGAAGGAGAAATGG
GCTGAAGAAGTGTAGGCTGTTTTGTACTTTGGTTTGCCCTGTACTTTTTGGGCAGCAGGT
GCAGTTTTACATTACCACAAATCAGGCAAGGCGTCTAAAATGTTGTACATTGTAGTTAGT
TCATACTCAATCGAATCCCACTTGCTGACACTGATTACTCAGTGAATTCTGCACTGTGAT
GAAGATGAACACACATATTCTCAGTTTCTCATGATGGTTTAGCAAGGTAGAACTGTCTTT
TGTAATGCTTCATTTTTTTAAGGCAATCTGCAATGCTTTGTTTGGTATTGCAGTGGTTTA
TAACTATCCCTGTAAATTTCTATTTTTGATGAAAATAGTTAGTGCTGTTATTTTTGGGAA
CT

CDS

648 bp

>Os09t0537600-01 Cyclophilin 21 protein, Peptidyl prolyl cis-trans isomerase (PPIase) activity, Negative regulation of ABA signalling, Regulation of seed germination and seedling growth and development
ATGCTGCGGAAGGTGGCCGTCGCCTTCCTCGCTTGCGCCGCCCTCTACCTCGCCTTCGCC
GCCTACTCCCGCCGCGAGAGCCTTGGAGAGGTTCGATTACCTGCAGTTACTAACAGGGTA
TACTTGGATGTGGAAATTGATGGGCAACATATAGGTAGAATTGTCATTGGCCTTTATGGA
GATGTTGTGCCAAAAACAGTTGCAAATTTTAGGGCTCTTTGTACAGGAGAAGAGGGCATT
GGGCACAAGGGTAAATCTCTTCACTATAAAGGATCAAGATTTCATCGTATTATCCCAGGC
TTCATGATTCAGGGTGGGGACATAGTTAGAGGTGATGGAAAAGGAAGTGAGTCTATATAT
GGGGGCACCTTCCCAGATGAGAATTTCATAGTAAAACATACACATCCAGGTGTTATTGCC
ATGGCAAATTCTGGACCTGATTCCAATGGATCGCAGTTTTACATTACCACAATCAAGACA
AGCTGGTTGGATGGGGAGCATGTTGTGTTTGGCAGGGTGATTCAGGGAATGGATTATGTG
TACGCCATTGAAGGGGGTGCTGGAACTTACAATGGCAAGCCTAGGAAGAAAGTTGTAATC
ACCGACTCTGGTGAGATACCGAAGGAGAAATGGGCTGAAGAAGTGTAG

Protein

216 aa

>Os09t0537600-01 Cyclophilin 21 protein, Peptidyl prolyl cis-trans isomerase (PPIase) activity, Negative regulation of ABA signalling, Regulation of seed germination and seedling growth and development
MLRKVAVAFLACAALYLAFAAYSRRESLGEVRLPAVTNRVYLDVEIDGQHIGRIVIGLYG
DVVPKTVANFRALCTGEEGIGHKGKSLHYKGSRFHRIIPGFMIQGGDIVRGDGKGSESIY
GGTFPDENFIVKHTHPGVIAMANSGPDSNGSQFYITTIKTSWLDGEHVVFGRVIQGMDYV
YAIEGGAGTYNGKPRKKVVITDSGEIPKEKWAEEV*

5'UTR

chr09:21151781..21151927 (+ strand) : 147 bp

CDS

chr09:21151928..21152005 (+ strand) : 78 bp

chr09:21152651..21152726 (+ strand) : 76 bp

chr09:21152867..21152914 (+ strand) : 48 bp

chr09:21153151..21153174 (+ strand) : 24 bp

chr09:21153268..21153450 (+ strand) : 183 bp

chr09:21153628..21153703 (+ strand) : 76 bp

chr09:21153778..21153940 (+ strand) : 163 bp

3'UTR

chr09:21153941..21154287 (+ strand) : 347 bp

FASTA

>Os09t0537600-01 class=Sequence position=chr09:21151781..21154287 (+ strand)
GTCTGCTTCG TCGCCGATCT CGTCTCCGCC GCCCGCGAGC GAATCGCCCC CAAATCGGGA GGGCGGCTGC TCTCGCCTGC
AGATTTGCGC CGTCGTTGCG GCGAATTGAT GAGGTAGAAG TGTCCAACTA CTCGCCCCTG GTTCGCGATG CTGCGGAAGG
TGGCCGTCGC CTTCCTCGCT TGCGCCGCCC TCTACCTCGC CTTCGCCGCC TACTCCCGCC GCGAGGTATG ATGGGCTTTC
TCTTACAGTT GGGGACGGAT TTGTTCGATT CGGTTGATCA GTGACCTACC GCGCGGCAAT TCTTGGCTTC GTAGGTAGTG
GCAACGGAGT GGAATTAGAC TGGATCTTTC TGTTCCACTG TTGATTTGTT CTACATGATG CAGTTGGGTT TTAGCTGCTC
GCACCTACAG TTCTGCAATG TGATGTCTGC AATTAGTATG CTCGTGTTGC GCTGCTCGAG ATGCTTCAGT AGCTAGACGA
TATTGTTTAC TAGTAGGATT GTAGAGAACA CCATCCCCAT AAATCGTTTA GGGGGAGACT TTTTTCTCAC CGGGCCAGAA
GGGAAAGACT TAAAGCAAGG AATACATATA TATGCGAGTT GCTGGCATCT GACTGCACAA TGATTTCTGT TTTGCTGACA
ACAGTAGCCT TATTGTACAA TGAGTTGAAC CTCATGACTA TGGCCATCAC TCCTTGTCTC AAGATTAGAA CATGGTGTTT
AGATTCTGAA AAATATATAG ACGTGGGGCG CTCGTTTCAT TTTGTGGACG ATCTGGGAGA TAGGTTCTGG CCTCGGTTAT
GGTGGTAGTG ACTAGTGAGA CGATGATTCA ATGTTACAGA ATATTTATTC TTCTTTCTCA CCTTGTACAG AGCCTTGGAG
AGGTTCGATT ACCTGCAGTT ACTAACAGGG TATACTTGGA TGTGGAAATT GATGGGCAAC ATATAGGTAT ATCACTATAT
CATCATGACA ATCTGTCTTG GATGTTCCAA TGGAAAGAAT AAAACTTGTT GCTTGCACCG TTACTATACA TGTCACTCAG
CTTAAGCCCT GGTTAACCTA ATTCTTGTGT GCTCCCCTCA TTACAGGTAG AATTGTCATT GGCCTTTATG GAGATGTTGT
GCCAAAAACA GTTGGTAATC TTACGCCCAT TCTTTTCTTC ATCATATTTA TTTACAAACT TGAGATTAAT CCTTTGGAGA
CAGTGGCATA GCAGATTGTG GAATTCTTAT GTTTTGTTTG TGTGGACAAT AAATCTCCCC TTGAAGATAC TTTGATTATC
ATTTGTAGCA TATAGTTTGT CCCATTTGTT TGCTACTGTA ATATAAATTG GCAATAATAG CTTGTTGATT TTTTATTTCT
CATTTTGCAG CAAATTTTAG GGCTCTTTGT ACAGGTATTT CTTCTTCCTA GATCTATTCC TGTTACAGCT GAAATTCAAC
CTTCTGTTCA CATGATTATC CATATTGCAC TCTGTTCACT ATTGCAGGAG AAGAGGGCAT TGGGCACAAG GGTAAATCTC
TTCACTATAA AGGATCAAGA TTTCATCGTA TTATCCCAGG CTTCATGATT CAGGGTGGGG ACATAGTTAG AGGTGATGGA
AAAGGAAGTG AGTCTATATA TGGGGGCACC TTCCCAGATG AGAATTTCAT AGTAAAACAT ACACATCCAG GTCAGAAATT
CAGAATGCTC AATTGATTTG TACTTTCTAC TTTACCTTTA TTTATGAGTT ATATGTATCG CTAAGTTGCA CATTTTTCTC
CTATACATGG AGCATAGATT TTTAGATATT CTTTATGCGC TCTGCCCTGC TTCTGATTAT CTCTCTTGGT CTGCTGTCAT
CATGCAGGTG TTATTGCCAT GGCAAATTCT GGACCTGATT CCAATGGATC GCAGTTTTAC ATTACCACAA TCAAGACAAG
CTGGTAAGTT GTATTACACT ATAAGTTACC AGTGATCAAT CTAGATGGTA CAACTCCTGA AATTATAAGT ACCGCAGGTT
GGATGGGGAG CATGTTGTGT TTGGCAGGGT GATTCAGGGA ATGGATTATG TGTACGCCAT TGAAGGGGGT GCTGGAACTT
ACAATGGCAA GCCTAGGAAG AAAGTTGTAA TCACCGACTC TGGTGAGATA CCGAAGGAGA AATGGGCTGA AGAAGTGTAG
GCTGTTTTGT ACTTTGGTTT GCCCTGTACT TTTTGGGCAG CAGGTGCAGT TTTACATTAC CACAAATCAG GCAAGGCGTC
TAAAATGTTG TACATTGTAG TTAGTTCATA CTCAATCGAA TCCCACTTGC TGACACTGAT TACTCAGTGA ATTCTGCACT
GTGATGAAGA TGAACACACA TATTCTCAGT TTCTCATGAT GGTTTAGCAA GGTAGAACTG TCTTTTGTAA TGCTTCATTT
TTTTAAGGCA ATCTGCAATG CTTTGTTTGG TATTGCAGTG GTTTATAACT ATCCCTGTAA ATTTCTATTT TTGATGAAAA
TAGTTAGTGC TGTTATTTTT GGGAACT

Locus: Os09g0537600

Loading...

Locus: Os09g0537600

Loading...