Os09t0537600-02

Locus

Os09g0537600

Description

Similar to Peptidyl-prolyl cis-trans isomerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP21-1

CGSNL Gene Name

CYCLOPHILIN 21-1

Oryzabase Gene Symbol Synonym(s)

OsCYP21-1, OsCYP-24

Oryzabase Gene Name Synonym(s)

cyclophilin 21-1, cyclophilin 24

Transcript Evidence

AK070944 (DDBJ, Best hit)

Protein Evidence

B8BDX4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

J023066C07 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0537600-02)

Others

Oryzabase (10062)

Transcript

2326 bp

>Os09t0537600-02 Similar to Peptidyl-prolyl cis-trans isomerase.
TCTGCTTCGTCGCCGATCTCGTCTCCGCCGCCCGCGAGCGAATCGCCCCCAAATCGGGAG
GGCGGCTGCTCTCGCCTGCAGATTTGCGCCGTCGTTGCGGCGAATTGATGAGGTAGAAGT
GTCCAACTACTCGCCCCTGGTTCGCGATGCTGCGGAAGGTGGCCGTCGCCTTCCTCGCTT
GCGCCGCCCTCTACCTCGCCTTCGCCGCCTACTCCCGCCGCGAGGTATGATGGGCTTTCT
CTTACAGTTGGGGACGGATTTGTTCGATTCGGTTGATCAGTGACCTACCGCGCGGCAATT
CTTGGCTTCGTAGGTAGTGGCAACGGAGTGGAATTAGACTGGATCTTTCTGTTCCACTGT
TGATTTGTTCTACATGATGCAGTTGGGTTTTAGCTGCTCGCACCTACAGTTCTGCAATGT
GATGTCTGCAATTAGTATGCTCGTGTTGCGCTGCTCGAGATGCTTCAGTAGCTAGACGAT
ATTGTTTACTAGTAGGATTGTAGAGAACACCATCCCCATAAATCGTTTAGGGGGAGACTT
TTTTCTCACCGGGCCAGAAGGGAAAGACTTAAAGCAAGGAATACATATATATGCGAGTTG
CTGGCATCTGACTGCACAATGATTTCTGTTTTGCTGACAACAGTAGCCTTATTGTACAAT
GAGTTGAACCTCATGACTATGGCCATCACTCCTTGTCTCAAGATTAGAACATGGTGTTTA
GATTCTGAAAAATATATAGACGTGGGGCGCTCGTTTCATTTTGTGGACGATCTGGGAGAT
AGGTTCTGGCCTCGGTTATGGTGGTAGTGACTAGTGAGACGATGATTCAATGTTACAGAA
TATTTATTCTTCTTTCTCACCTTGTACAGAGCCTTGGAGAGGTTCGATTACCTGCAGTTA
CTAACAGGGTATACTTGGATGTGGAAATTGATGGGCAACATATAGGTATATCACTATATC
ATCATGACAATCTGTCTTGGATGTTCCAATGGAAAGAATAAAACTTGTTGCTTGCACCGT
TACTATACATGTCACTCAGCTTAAGCCCTGGTTAACCTAATTCTTGTGTGCTCCCCTCAT
TACAGGTAGAATTGTCATTGGCCTTTATGGAGATGTTGTGCCAAAAACAGTTGGTAATCT
TACGCCCATTCTTTTCTTCATCATATTTATTTACAAACTTGAGATTAATCCTTTGGAGAC
AGTGGCATAGCAGATTGTGGAATTCTTATGTTTTGTTTGTGTGGACAATAAATCTCCCCT
TGAAGATACTTTGATTATCATTTGTAGCATATAGTTTGTCCCATTTGTTTGCTACTGTAA
TATAAATTGGCAATAATAGCTTGTTGATTTTTTATTTCTCATTTTGCAGCAAATTTTAGG
GCTCTTTGTACAGGTATTTCTTCTTCCTAGATCTATTCCTGTTACAGCTGAAATTCAACC
TTCTGTTCACATGATTATCCATATTGCACTCTGTTCACTATTGCAGGAGAAGAGGGCATT
GGGCACAAGGGTAAATCTCTTCACTATAAAGGATCAAGATTTCATCGTATTATCCCAGGC
TTCATGATTCAGGGTGGGGACATAGTTAGAGGTGATGGAAAAGGAAGTGAGTCTATATAT
GGGGGCACCTTCCCAGATGAGAATTTCATAGTAAAACATACACATCCAGGTGTTATTGCC
ATGGCAAATTCTGGACCTGATTCCAATGGATCGCAGTTTTACATTACCACAATCAAGACA
AGCTGGTTGGATGGGGAGCATGTTGTGTTTGGCAGGGTGATTCAGGGAATGGATTATGTG
TACGCCATTGAAGGGGGTGCTGGAACTTACAATGGCAAGCCTAGGAAGAAAGTTGTAATC
ACCGACTCTGGTGAGATACCGAAGGAGAAATGGGCTGAAGAAGTGTAGGCTGTTTTGTAC
TTTGGTTTGCCCTGTACTTTTTGGGCAGCAGGTGCAGTTTTACATTACCACAAATCAGGC
AAGGCGTCTAAAATGTTGTACATTGTAGTTAGTTCATACTCAATCGAATCCCACTTGCTG
ACACTGATTACTCAGTGAATTCTGCACTGTGATGAAGATGAACACACATATTCTCAGTTT
CTCATGATGGTTTAGCAAGGTAGAACTGTCTTTTGTAATGCTTCATTTTTTTAAGGCAAT
CTGCAATGCTTTGTTTGGTATTGCAGTGGTTTATAACTATCCCTGTAAATTTCTATTTTT
GATGAAAATAGTTAGTGCTGTTATTTTTGGGAACTAATTACAATGCACAATACTGGTTGG
CCTACTCAGATCAATTTATGAAAATATGCACGTGTATGTTGTTGTC

CDS

477 bp

>Os09t0537600-02 Similar to Peptidyl-prolyl cis-trans isomerase.
AATTCAACCTTCTGTTCACATGATTATCCATATTGCACTCTGTTCACTATTGCAGGAGAA
GAGGGCATTGGGCACAAGGGTAAATCTCTTCACTATAAAGGATCAAGATTTCATCGTATT
ATCCCAGGCTTCATGATTCAGGGTGGGGACATAGTTAGAGGTGATGGAAAAGGAAGTGAG
TCTATATATGGGGGCACCTTCCCAGATGAGAATTTCATAGTAAAACATACACATCCAGGT
GTTATTGCCATGGCAAATTCTGGACCTGATTCCAATGGATCGCAGTTTTACATTACCACA
ATCAAGACAAGCTGGTTGGATGGGGAGCATGTTGTGTTTGGCAGGGTGATTCAGGGAATG
GATTATGTGTACGCCATTGAAGGGGGTGCTGGAACTTACAATGGCAAGCCTAGGAAGAAA
GTTGTAATCACCGACTCTGGTGAGATACCGAAGGAGAAATGGGCTGAAGAAGTGTAG

Protein

159 aa

>Os09t0537600-02 Similar to Peptidyl-prolyl cis-trans isomerase.
NSTFCSHDYPYCTLFTIAGEEGIGHKGKSLHYKGSRFHRIIPGFMIQGGDIVRGDGKGSE
SIYGGTFPDENFIVKHTHPGVIAMANSGPDSNGSQFYITTIKTSWLDGEHVVFGRVIQGM
DYVYAIEGGAGTYNGKPRKKVVITDSGEIPKEKWAEEV*

5'UTR

chr09:21151782..21153212 (+ strand) : 1431 bp

CDS

chr09:21153213..21153450 (+ strand) : 238 bp

chr09:21153628..21153703 (+ strand) : 76 bp

chr09:21153778..21153940 (+ strand) : 163 bp

3'UTR

chr09:21153941..21154358 (+ strand) : 418 bp

FASTA

>Os09t0537600-02 class=Sequence position=chr09:21151782..21154358 (+ strand)
TCTGCTTCGT CGCCGATCTC GTCTCCGCCG CCCGCGAGCG AATCGCCCCC AAATCGGGAG GGCGGCTGCT CTCGCCTGCA
GATTTGCGCC GTCGTTGCGG CGAATTGATG AGGTAGAAGT GTCCAACTAC TCGCCCCTGG TTCGCGATGC TGCGGAAGGT
GGCCGTCGCC TTCCTCGCTT GCGCCGCCCT CTACCTCGCC TTCGCCGCCT ACTCCCGCCG CGAGGTATGA TGGGCTTTCT
CTTACAGTTG GGGACGGATT TGTTCGATTC GGTTGATCAG TGACCTACCG CGCGGCAATT CTTGGCTTCG TAGGTAGTGG
CAACGGAGTG GAATTAGACT GGATCTTTCT GTTCCACTGT TGATTTGTTC TACATGATGC AGTTGGGTTT TAGCTGCTCG
CACCTACAGT TCTGCAATGT GATGTCTGCA ATTAGTATGC TCGTGTTGCG CTGCTCGAGA TGCTTCAGTA GCTAGACGAT
ATTGTTTACT AGTAGGATTG TAGAGAACAC CATCCCCATA AATCGTTTAG GGGGAGACTT TTTTCTCACC GGGCCAGAAG
GGAAAGACTT AAAGCAAGGA ATACATATAT ATGCGAGTTG CTGGCATCTG ACTGCACAAT GATTTCTGTT TTGCTGACAA
CAGTAGCCTT ATTGTACAAT GAGTTGAACC TCATGACTAT GGCCATCACT CCTTGTCTCA AGATTAGAAC ATGGTGTTTA
GATTCTGAAA AATATATAGA CGTGGGGCGC TCGTTTCATT TTGTGGACGA TCTGGGAGAT AGGTTCTGGC CTCGGTTATG
GTGGTAGTGA CTAGTGAGAC GATGATTCAA TGTTACAGAA TATTTATTCT TCTTTCTCAC CTTGTACAGA GCCTTGGAGA
GGTTCGATTA CCTGCAGTTA CTAACAGGGT ATACTTGGAT GTGGAAATTG ATGGGCAACA TATAGGTATA TCACTATATC
ATCATGACAA TCTGTCTTGG ATGTTCCAAT GGAAAGAATA AAACTTGTTG CTTGCACCGT TACTATACAT GTCACTCAGC
TTAAGCCCTG GTTAACCTAA TTCTTGTGTG CTCCCCTCAT TACAGGTAGA ATTGTCATTG GCCTTTATGG AGATGTTGTG
CCAAAAACAG TTGGTAATCT TACGCCCATT CTTTTCTTCA TCATATTTAT TTACAAACTT GAGATTAATC CTTTGGAGAC
AGTGGCATAG CAGATTGTGG AATTCTTATG TTTTGTTTGT GTGGACAATA AATCTCCCCT TGAAGATACT TTGATTATCA
TTTGTAGCAT ATAGTTTGTC CCATTTGTTT GCTACTGTAA TATAAATTGG CAATAATAGC TTGTTGATTT TTTATTTCTC
ATTTTGCAGC AAATTTTAGG GCTCTTTGTA CAGGTATTTC TTCTTCCTAG ATCTATTCCT GTTACAGCTG AAATTCAACC
TTCTGTTCAC ATGATTATCC ATATTGCACT CTGTTCACTA TTGCAGGAGA AGAGGGCATT GGGCACAAGG GTAAATCTCT
TCACTATAAA GGATCAAGAT TTCATCGTAT TATCCCAGGC TTCATGATTC AGGGTGGGGA CATAGTTAGA GGTGATGGAA
AAGGAAGTGA GTCTATATAT GGGGGCACCT TCCCAGATGA GAATTTCATA GTAAAACATA CACATCCAGG TCAGAAATTC
AGAATGCTCA ATTGATTTGT ACTTTCTACT TTACCTTTAT TTATGAGTTA TATGTATCGC TAAGTTGCAC ATTTTTCTCC
TATACATGGA GCATAGATTT TTAGATATTC TTTATGCGCT CTGCCCTGCT TCTGATTATC TCTCTTGGTC TGCTGTCATC
ATGCAGGTGT TATTGCCATG GCAAATTCTG GACCTGATTC CAATGGATCG CAGTTTTACA TTACCACAAT CAAGACAAGC
TGGTAAGTTG TATTACACTA TAAGTTACCA GTGATCAATC TAGATGGTAC AACTCCTGAA ATTATAAGTA CCGCAGGTTG
GATGGGGAGC ATGTTGTGTT TGGCAGGGTG ATTCAGGGAA TGGATTATGT GTACGCCATT GAAGGGGGTG CTGGAACTTA
CAATGGCAAG CCTAGGAAGA AAGTTGTAAT CACCGACTCT GGTGAGATAC CGAAGGAGAA ATGGGCTGAA GAAGTGTAGG
CTGTTTTGTA CTTTGGTTTG CCCTGTACTT TTTGGGCAGC AGGTGCAGTT TTACATTACC ACAAATCAGG CAAGGCGTCT
AAAATGTTGT ACATTGTAGT TAGTTCATAC TCAATCGAAT CCCACTTGCT GACACTGATT ACTCAGTGAA TTCTGCACTG
TGATGAAGAT GAACACACAT ATTCTCAGTT TCTCATGATG GTTTAGCAAG GTAGAACTGT CTTTTGTAAT GCTTCATTTT
TTTAAGGCAA TCTGCAATGC TTTGTTTGGT ATTGCAGTGG TTTATAACTA TCCCTGTAAA TTTCTATTTT TGATGAAAAT
AGTTAGTGCT GTTATTTTTG GGAACTAATT ACAATGCACA ATACTGGTTG GCCTACTCAG ATCAATTTAT GAAAATATGC
ACGTGTATGT TGTTGTC

Locus: Os09g0537600

Loading...

Locus: Os09g0537600

Loading...