Os09t0539400-00

Locus

Os09g0539400

Description

Similar to MCM10 minichromosome maintenance deficient 10.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM10

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 10

Oryzabase Gene Symbol Synonym(s)

OsMCM10

Oryzabase Gene Name Synonym(s)

mini-chromosome maintenance protein 10

Transcript Evidence

EU963299 (DDBJ)

Protein Evidence

B6TE84 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Zinc finger, Mcm10/DnaG-type (IPR015408)

Expression Databases

TENOR (Os09t0539400-00)

Others

Oryzabase (7360)

KEGG (Os09t0539400-00)

Transcript

1359 bp

>Os09t0539400-00 Similar to MCM10 minichromosome maintenance deficient 10.
TCCCATCTCTCTCTGCATTTCTCGATCTGATTCCTGTGCGCAATCGGCAGCGCGCGGATT
CCAGTGGTGCTCCTCCACGCCTCGCCGCTGCATCTCCACCCATGGCGACCGCCGCCGCCG
CCGACGACCTGGACCTCCTCCTCTCCCTTGACGCGGACGGCGGCGAGGCCGTCCTCGAGA
CCCCTCCCTCCTCCCCGCGCCGCGACGCCGCCACCGCCGCGGCCTTCACCCCTCCCAGGG
CGGTGCGCCCCGGCGGCACCGACATGTCCGTGTTCCGTGACGCCGTCAAGGACTACCTCG
ACGCCACCCCCGCCGCCGTCGCAACCTCTCTCCCCAAGGGGAAGAGGCCCCCCAAGTCCA
CCGAGACCATCGTCGACGCCCACTCCGGCCTCCGCATCAGGAGCCTGACGGCGTCGCCGC
TCGAGATCACCAACCGCTTCGCCGACATTCGGTTCGTCCGCATCTCCGCCATCAGGAACC
TCGCCGGGGGCGACAGCTTCTCCGGCTGCTGGGCGACGGCGGGGGTGGTGCTCGACAAGG
GCGCGCCGCGGGTGAGCGCGCAGGGGAAGGAGTACAGCATCTGGAAGATGGGCGCGCTCG
ACGACGCCGACGTGTCGGTGTTCCTCTTCGGGGACGCCCACGCGCACCACTCCGGCGCCG
CCGTCGGCGCCGTGTTCGCGCTGTTCAACGGCAATGTCCGCATGGACAACGGGGGGAGAG
GGTTCTCGGTGAGCGTCGCCTCCGTAGGGCAGATGATGAAGATGGGAGTCTCCGCGGATT
TCGGGATCTGCAAGGGGAAGAGGAAAGATGGGATGGGCTGCACCATGGCCATAAACAAGC
GTAAAGGATCATACTGCAAATTTCATTCATCGAAATCCTCACAGAAGTACTCTACTGGCA
GGGTAGAGCTTAAGGGCGGAAACTTCAAATTTGCTTCAAAACTTCGTTCAGAAGGGATTT
ACATGGTCAATCCCCTAGAACGATCCAATTCAAGAAACCCATTACAACCAGTAAAAGTGA
TGTCAATAGATGGGTTAAAAAGGGCTTTGAGTAATGCAGATAGAGTGACTGCTAAGAGCC
AGTCACAGGGTATAAGGTTCCTTTCCCATGTTACAGGTACAAAGCTACGTAATATAGAAT
CAAATTTGTCCAGCAATGGTTCCACCAATCCACAGACATCAAGGTTCAGCTCAAACAAAA
GGTCCACATCTTGTAGCACCAAATCAATGCCCAAACCGGGATTACAAAAGCAAGAGCAAG
ATAACAAGAAAATGAAGATGACATGCCCTCCAAAGAAAACGATTGAGCTTGATGACGTCA
GCTCGGACGATGAGATCAGTATAGTGCTAAGACGCTGAT

CDS

1257 bp

>Os09t0539400-00 Similar to MCM10 minichromosome maintenance deficient 10.
ATGGCGACCGCCGCCGCCGCCGACGACCTGGACCTCCTCCTCTCCCTTGACGCGGACGGC
GGCGAGGCCGTCCTCGAGACCCCTCCCTCCTCCCCGCGCCGCGACGCCGCCACCGCCGCG
GCCTTCACCCCTCCCAGGGCGGTGCGCCCCGGCGGCACCGACATGTCCGTGTTCCGTGAC
GCCGTCAAGGACTACCTCGACGCCACCCCCGCCGCCGTCGCAACCTCTCTCCCCAAGGGG
AAGAGGCCCCCCAAGTCCACCGAGACCATCGTCGACGCCCACTCCGGCCTCCGCATCAGG
AGCCTGACGGCGTCGCCGCTCGAGATCACCAACCGCTTCGCCGACATTCGGTTCGTCCGC
ATCTCCGCCATCAGGAACCTCGCCGGGGGCGACAGCTTCTCCGGCTGCTGGGCGACGGCG
GGGGTGGTGCTCGACAAGGGCGCGCCGCGGGTGAGCGCGCAGGGGAAGGAGTACAGCATC
TGGAAGATGGGCGCGCTCGACGACGCCGACGTGTCGGTGTTCCTCTTCGGGGACGCCCAC
GCGCACCACTCCGGCGCCGCCGTCGGCGCCGTGTTCGCGCTGTTCAACGGCAATGTCCGC
ATGGACAACGGGGGGAGAGGGTTCTCGGTGAGCGTCGCCTCCGTAGGGCAGATGATGAAG
ATGGGAGTCTCCGCGGATTTCGGGATCTGCAAGGGGAAGAGGAAAGATGGGATGGGCTGC
ACCATGGCCATAAACAAGCGTAAAGGATCATACTGCAAATTTCATTCATCGAAATCCTCA
CAGAAGTACTCTACTGGCAGGGTAGAGCTTAAGGGCGGAAACTTCAAATTTGCTTCAAAA
CTTCGTTCAGAAGGGATTTACATGGTCAATCCCCTAGAACGATCCAATTCAAGAAACCCA
TTACAACCAGTAAAAGTGATGTCAATAGATGGGTTAAAAAGGGCTTTGAGTAATGCAGAT
AGAGTGACTGCTAAGAGCCAGTCACAGGGTATAAGGTTCCTTTCCCATGTTACAGGTACA
AAGCTACGTAATATAGAATCAAATTTGTCCAGCAATGGTTCCACCAATCCACAGACATCA
AGGTTCAGCTCAAACAAAAGGTCCACATCTTGTAGCACCAAATCAATGCCCAAACCGGGA
TTACAAAAGCAAGAGCAAGATAACAAGAAAATGAAGATGACATGCCCTCCAAAGAAAACG
ATTGAGCTTGATGACGTCAGCTCGGACGATGAGATCAGTATAGTGCTAAGACGCTGA

Protein

419 aa

>Os09t0539400-00 Similar to MCM10 minichromosome maintenance deficient 10.
MATAAAADDLDLLLSLDADGGEAVLETPPSSPRRDAATAAAFTPPRAVRPGGTDMSVFRD
AVKDYLDATPAAVATSLPKGKRPPKSTETIVDAHSGLRIRSLTASPLEITNRFADIRFVR
ISAIRNLAGGDSFSGCWATAGVVLDKGAPRVSAQGKEYSIWKMGALDDADVSVFLFGDAH
AHHSGAAVGAVFALFNGNVRMDNGGRGFSVSVASVGQMMKMGVSADFGICKGKRKDGMGC
TMAINKRKGSYCKFHSSKSSQKYSTGRVELKGGNFKFASKLRSEGIYMVNPLERSNSRNP
LQPVKVMSIDGLKRALSNADRVTAKSQSQGIRFLSHVTGTKLRNIESNLSSNGSTNPQTS
RFSSNKRSTSCSTKSMPKPGLQKQEQDNKKMKMTCPPKKTIELDDVSSDDEISIVLRR*

5'UTR

chr09:21239649..21239749 (+ strand) : 101 bp

CDS

chr09:21239750..21240123 (+ strand) : 374 bp

chr09:21240213..21240450 (+ strand) : 238 bp

chr09:21240533..21240657 (+ strand) : 125 bp

chr09:21241075..21241108 (+ strand) : 34 bp

chr09:21241197..21241243 (+ strand) : 47 bp

chr09:21241341..21241472 (+ strand) : 132 bp

chr09:21241813..21241889 (+ strand) : 77 bp

chr09:21242006..21242078 (+ strand) : 73 bp

chr09:21242183..21242339 (+ strand) : 157 bp

3'UTR

chr09:21242340..21242340 (+ strand) : 1 bp

FASTA

>Os09t0539400-00 class=Sequence position=chr09:21239649..21242340 (+ strand)
TCCCATCTCT CTCTGCATTT CTCGATCTGA TTCCTGTGCG CAATCGGCAG CGCGCGGATT CCAGTGGTGC TCCTCCACGC
CTCGCCGCTG CATCTCCACC CATGGCGACC GCCGCCGCCG CCGACGACCT GGACCTCCTC CTCTCCCTTG ACGCGGACGG
CGGCGAGGCC GTCCTCGAGA CCCCTCCCTC CTCCCCGCGC CGCGACGCCG CCACCGCCGC GGCCTTCACC CCTCCCAGGG
CGGTGCGCCC CGGCGGCACC GACATGTCCG TGTTCCGTGA CGCCGTCAAG GACTACCTCG ACGCCACCCC CGCCGCCGTC
GCAACCTCTC TCCCCAAGGG GAAGAGGCCC CCCAAGTCCA CCGAGACCAT CGTCGACGCC CACTCCGGCC TCCGCATCAG
GAGCCTGACG GCGTCGCCGC TCGAGATCAC CAACCGCTTC GCCGACATTC GGTTCGTCCG CATCTCCGCC ATCAGGTAAG
GATTCAGGCT CACCCCGCCG CCTTGTTTGC ATCGCTGGGT TGTTTGTGTT TGTGTTTGCG CCGCTCTAAT CGATTGGTGC
GCAGGAACCT CGCCGGGGGC GACAGCTTCT CCGGCTGCTG GGCGACGGCG GGGGTGGTGC TCGACAAGGG CGCGCCGCGG
GTGAGCGCGC AGGGGAAGGA GTACAGCATC TGGAAGATGG GCGCGCTCGA CGACGCCGAC GTGTCGGTGT TCCTCTTCGG
GGACGCCCAC GCGCACCACT CCGGCGCCGC CGTCGGCGCC GTGTTCGCGC TGTTCAACGG CAATGTCCGC ATGGACAACG
GGGTACCTGA TTTCTCCATT TTGCATTTCT CATCAGGGTT GATTTGTGCT CATCAGAGTG ATGCTGATTT GGGTGTTCTT
GCAGGGGAGA GGGTTCTCGG TGAGCGTCGC CTCCGTAGGG CAGATGATGA AGATGGGAGT CTCCGCGGAT TTCGGGATCT
GCAAGGGGAA GAGGAAAGAT GGGATGGGCT GCACCATGGC CATAAACAAG TATGCATTTC CTCTGCAACG ATGAGAACTT
TGTTTCAAAA CTTAACCTGT TGGGTTGTAT CTGCTTAAGA TGTGAAATAT CTTTCTGGGC AAGGTATTAA CAAAAATCTA
ATATGCACTG ATGCCGATAT TAAGCTAATT TCAGTTTGCC TGGGTGGATT ATGTTCTGGA TATTTCAGAT ACATTTTCAA
CCATGAAAGC AAATTGTAAC TGAACACCAA TTTTATCATA GATCTTAAGA TTCGCATTTA CATGTGGTTG TACTTAGATA
ACTAAAGTTT TACACCTGGT CACAAAAAGA AATAATTTCA CAGCATTTCT TTTTGTGTGA TATCTGAACC AAAAATCAGA
TGAATCTGCT TGGTTTTCAT GGATGTATCT ATGGGCCTCT ACTGAATATT CTCTGTACAT TTTCAGGCGT AAAGGATCAT
ACTGCAAATT TCATTCATCG GTAAGGACGG AAGTTGTGAT TTCCAGCATT TTGCAACTCA AAATAGATTA ATTTCACATG
ACGCATCTCG CTTATTTCCT ATTGGCAGAA ATCCTCACAG AAGTACTCTA CTGGCAGGGT AGAGCTTAAG GGCGGGTAAG
TGAATTAGTG AACCCCCAAA GGGATCTTCT ATATTTCCCC TTGATATAGT TTTAAGATAT CTTTGTTGAA CTTTGCATGC
TATATCTTTC AGAAACTTCA AATTTGCTTC AAAACTTCGT TCAGAAGGGA TTTACATGGT CAATCCCCTA GAACGATCCA
ATTCAAGAAA CCCATTACAA CCAGTAAAAG TGATGTCAAT AGATGGGTTA AAAAGGGCTT TGAGGTATGA AATACTATCC
CAGCTGCCAT CTTTGCATAT TGTTCTGTTC ACATTTCATG TTCTTTCCTG ACAAAAGTCA ACTTCAATAG CGAATGAAAC
AGTGTTGAAA TATGGAAATG ATTGTATTAC AGTTGTCCTG CTAGATAAAG TAAGCACATA CTTCATTTGT AGTCAAATCT
TTTTGGAGGT CATGTGTGGC ATGAAATGGT ATGTAAATTG AACTGTCCTA GGAAATGATT TTTGGCTTGT GACACCTAGA
TTCCTAGAAG AATCCCCAAA TGAATGGCAG CTTAGAATTA CCATGCTAAA TAGTTTATGT ATTAATTCTT ATTTTGTTTT
GCAGTAATGC AGATAGAGTG ACTGCTAAGA GCCAGTCACA GGGTATAAGG TTCCTTTCCC ATGTTACAGG TACAAAGCTA
CGTTTCCCCT TCCATTCCAG TGGGCGTAAT AATTTAACGA AAGTAGCACC AACTTAACGA AAGAAAAATG TTATGATTGC
TTTGCATTCA GAACTGATTT TCTTCTGCAT TGATCAGGTA ATATAGAATC AAATTTGTCC AGCAATGGTT CCACCAATCC
ACAGACATCA AGGTTCAGCT CAAACAAAAG GTTTGTGTCA AAACTATATG TCGCTTGGTT TGCTTACTGT AGTCTTTATG
TCCCACTCTA TCAACCAATG ACATTTAAAC TGAGCAAGCT TCACTTACAT GTAGGTCCAC ATCTTGTAGC ACCAAATCAA
TGCCCAAACC GGGATTACAA AAGCAAGAGC AAGATAACAA GAAAATGAAG ATGACATGCC CTCCAAAGAA AACGATTGAG
CTTGATGACG TCAGCTCGGA CGATGAGATC AGTATAGTGC TAAGACGCTG AT