Os09t0551900-01

Locus

Os09g0551900

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FSV1

CGSNL Gene Name

FEMALE STERILE VARIATION 1

Oryzabase Gene Symbol Synonym(s)

OsFSV1, OsMLH3, MLH3

Oryzabase Gene Name Synonym(s)

MutL-homolog 3, female sterile variation 1

Transcript Evidence

AK287685 (DDBJ, Best hit)

Protein Evidence

Q69MM0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: mismatch repair (GO:0006298)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: mismatched DNA binding (GO:0030983)

Functional domain (InterPro)

DNA mismatch repair protein (IPR002099)

ATPase-like, ATP-binding domain (IPR003594)

Full-length cDNA

J065124P13 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0551900-01)

Others

Oryzabase (23965)

KEGG (Os09t0551900-01)

Transcript

4284 bp

>Os09t0551900-01 Hypothetical conserved gene.
AGTGTCATTTGCCCGCCTCACCTGCACTCTCTCCATCTCTCTCCTCCGGCGAAGGCGCGG
CGCGGCGGCGTTCTCCCCCCGCCTCGCCTCCTCCTCCTCGCGCGCGCGGCCGCGGCGAGC
CAGGCTCGGAGGCGGCGGCGTTGACGGGACGGGCTCCTCTCCTCTCCTCCCCGACCACAC
CCTACCTTCGCCCCCGCGCTGCCTCCTCGCGCGCACGGCCGGGAGACAAGCCAGGGGCGA
CGCGGCCGGCCTCGCTCCGCTCGGCTCCATCTCGGTTCCAGTCGAATTGGAGAATGCTTA
AATGCAGACAATAAAACGGTTGCCAAAAAGTGTCCATAGCTCGTTGCGCTCAAGCATTGT
TCTATTTGACCTATCAAGGGTTGTTGAGGAGCTGGTATATAATAGCATTGACGCAAATGC
GAGCAAGATTGACATCTCAGTGAATGCCAGAGCATGTTATGTTAAAGTGGAAGATGATGG
CTGTGGTATTACTCGTGACGAACTGGTTCTTGTAGGAGAAAAATATGCAACATCCAAGTT
TCATAATGTCATGGTTGATGGGGAACCTAGTTCCAGAAGTTTTGGATTAAATGGCGAAGC
ACTCGCATCACTATCTGATATCTCTGTTGTTGAAGTCAGGACAAAAGCTCGCGGGCGACC
AAATTCATATTGCAAGATAATAAAGGGATCCAAATGCTCACACCTGGGAATAGATGAGCA
GAGGGAAGTTGTTGGAACCACAGTTATTGTTCGCGAGCTTTTTTACAATCAACCTGTACG
CAGGAAACAAATGCAATCTAGTTACAAAAGAGAACTACATCTTGTGAAGAAGTCTGTTCT
GCGAGTTGCACTCATTCATCCACAAGTTTCACTCAGACTTTTTGATATTGAGAGTGAAGA
TGAGTTGCTATACACGATTCCTTCATCCTCCCCCTTGCCTCTTGTATCAAACATTTTGGG
GAAAAATGTCTCCAGCTGTCTTCATGAGATAGCTACCTCTGACAAGCATTTTGCTCTTTC
AGGGCACATCTCCAGACCAACAGATGTGTTCTGTAATAAGGATTTCCAGTACTTGTGTAT
CCTACAATCCAGTTCTTCACTGTCTATTTCCATAGTTTCACATACCATTTTTCTGAAAGC
TTGAGTTGGGAGATATCCTTGACTTTCCAAAGATATCAACTCAAGATTCGTCAGTAAAAG
CCCAATCCACAATATGCTCAATAACCTGGCATCTAGTTTTCAATCTTCTGCAAGGAATGA
GGAAATTGATGTTCGGAGTAAGAAGAGGCAGAAGAATGAAGTCTACCCTGCATATCTGCT
AAACTTGTGCTGTCCTAGATCAAGCTATGATCTACATTTTGAGCCTTCACAGACTATTGT
GGAATTCAAGGATTGGCAAACTGTCATGTATTTCTTTGAACGAACTATCACAGACTATTG
GAAGAAGCATGCACCTCAACTGCCAGAAGTGAAAGCTATTGGCAATGATACCTGTGTGCC
TTTGGAAAGAGATGTGAAATCAAGTCAGGAACTGTTAAGGCGTCATGGTGTGCAGAAGAA
AGAAGATGTCGCTGAATTGTACCAAACAGCTCTGCAGAAGAATACAGTACGAGACATGAA
TTTTGATACAGCTGCCCCAGCAGAACCTAAAGACAATTACCTTTCTTTGGATATGGAGCC
ATCCACATGGCGTGCCTGCTATGACCAGATCAGTGATGCATCCCACACAGATGATGTTGC
TAGGAATGGTCGGAAATTTGGTCATAAGCAAATATGTTCCCTTCAAAGTTATAGTTATCA
GTGGTTAGAGGACGGCTCTTCCCTGTTAGAAGACTCTGATCTTTCAAGTGCTAACCCAAC
TATTTGTAAAATGCAAAAGACAGAAGATATATTCCATGGGCATGCATATTCTGGTAAGTT
TGGACTGCTACAAGATGCAGAAATCGAAATCGGTCCAGAAATTAAACTCCAAGAATATTG
CTTTGAATCTCCCAATAAACCGAACAGAATGACCTGCGATTTTGTGCAAAAGCAAACCAA
TATAGAGGCACACATTTCAGGCCGTGATGGATTCTATGTTGATTTTGATAAATTGAACGA
GGACTGTCTACTCAATGAGATATCAAAGACAATCACTGATGTTTCCTGCCCTCAAATGCC
ACACTTTAATGATGGACTCTGTCCTGAGGACGTTGGCTCCTCCAAGAGTTCCTGTAGTGT
CAGGAAAAAGTCTAGTAAAAGGCAAAATAGTGCTAATGCAATTGCCCAGATGAAGTTCCA
TGATATGCAAGCAGTTTGCGAAAGTGATTACATGGATAGGTCCTTCATCAAGGATACATG
TGGCCTTCATTTCTTTCATCCATTCTCGTTGGCTGATACACCTCGCAGTCACAGTCGTGC
AAGGATTGACTTGGAATTGCATGGAAGGTCAAATGAAAGCATTAACAGTTGGAACTGTGA
AAATATTGGCACTGATTTTGGATTTACTTCAGACAGGTTTAATATTGATTCATCAATGAT
TTTTGAAGGAAGCAAACATCTCAATAACTTTGGCAATGGAACTCAATCTCCTAGTTACTT
CAATCATGAATATTGTTCTGTCGGTCAGTTTGCTTCCAAACAGGATCGGATACCCTTGAA
ATCAAAACATGATGCAAGAATGTCATATGATATTTCTCCTGAGAAAAGTTCTACTGGTTG
TCATTTGAATGTTTCTTTTTCCCAAGTGGCAAAAAGCAGCAAGCTTACTGAAGATCAGTA
TGGATGCAGTCAGAGGCCCAGGCTTTCCAGAGGTAGATATAGGAGTCGTTCTGCACCACC
ATTTTACAGAGGCAAAAGAAAATTCCCTAGATTAAACGAACCACTAACCAAATTGACTAC
AGAAGGTGGTAAATATACCACTGTTAATGACTCAGGAGATATCACACCTGTTCAGGAGTA
TACATCACATATGAACGCAACCCAACCTATTCCTGAGACCTTTAGCAATGACTTTTCTGA
CCTAAATTTCAGCTTGAAGGGAAATGTCAAAATGTGCGAAGAGAAATGTTCTGATGAACT
CGAAGATTCTACTGCTTCAGATGAAATAACAAAATGGCGTGATGACTCTGACCATCATGC
AGTTGAGCATTTTGTGCCAAGAGTTATATCACTGTGCACAATTTTCTATGCTCATATTTT
ATCTCTCTGTGTAGGTTTCGGAGTTGCAACATGGTCCTTTTGAACACGATGATGATGTAC
TTAGCATTTCTTATGGGCCCTTACACCTCTCATGCAGTGTTCTAGTTCCTGAATGTATTG
ATAAAAATTGCTTTGAGGAGGCAAGAGTTTTGTTGCAGCTGGATAAGAAATTTATTCCTG
TCATATCTGGGGAAGTACTACTCCTTGTTGATCAGCATGCAGCTGATGAAAGGATACGTT
TGGAGGAACTCCGTCGAAAGGTTTTATCAGATGATGGCAGAGGGATTACTTACTTGGACT
CTGAGGAGGACTTAGTTCTCCCTGAGACTGGATTTCAATTGTTCCAAAAGTATATGCAAC
AGATCCAAAGTTGGGGCTGGATCATCAACAGTACTAATTCCTGTGAATCATTCAAAAAGA
ACATGAACGTTCTGAGGAGACAATCGCGCCGTCTTACTCTTGCTGCTGTTCCATGTATTT
TGGGCGTCACTTTAACAGGAAAAGATCTTATGGACTTCATTCAGCAGCTTGATGACACAG
ATGGGTCGTCAGCTATCCCCCCAGCGGTCATTCGTATTCTCAATTTCAAGGCTTGCAGAG
GTGCGATCATGTTTGGCGATCCTCTGCTACCATCGGAGTGCTCTCTGATTATCGAAGAAC
TGAAAGCAACATCTTTATGTTTCCAGTGTGCTCATGGACGTCCGACCACCGTGCCGATTG
TGAACGTCGCATCTCTCCGCGGCGAGTTGGCGAGGCTCGGAGCGGTGAACGGAAGGCAAG
AAGAGACCTGGCATGGTCTCTCGCACCATGGACCCAGCCTTGAACGTGCTCGAACGCGCC
TCAGAGAACTGAGAAAGCTACGTGGTGGCCTGTAGCTGTACAACAGTACAAGATGTAGGA
TCATATAGAGGGTAAATAGTCCAAAAGAAAAGGAGAAGTGTTGCATAGTGCTTCAATAGG
AAGCGGCTTTGTAGTTTGCAGAGATAGATATGCCATTGGTTCACGAAGAAGAGGTAAAAT
GGCCATGAGCCGTGTTGTACACTTGTAAACCATTGTGATTTGTGAAGGCCATTCTCACCC
TGTAAATATATGACAATATTTTTC

CDS

843 bp

>Os09t0551900-01 Hypothetical conserved gene.
ATGCAGACAATAAAACGGTTGCCAAAAAGTGTCCATAGCTCGTTGCGCTCAAGCATTGTT
CTATTTGACCTATCAAGGGTTGTTGAGGAGCTGGTATATAATAGCATTGACGCAAATGCG
AGCAAGATTGACATCTCAGTGAATGCCAGAGCATGTTATGTTAAAGTGGAAGATGATGGC
TGTGGTATTACTCGTGACGAACTGGTTCTTGTAGGAGAAAAATATGCAACATCCAAGTTT
CATAATGTCATGGTTGATGGGGAACCTAGTTCCAGAAGTTTTGGATTAAATGGCGAAGCA
CTCGCATCACTATCTGATATCTCTGTTGTTGAAGTCAGGACAAAAGCTCGCGGGCGACCA
AATTCATATTGCAAGATAATAAAGGGATCCAAATGCTCACACCTGGGAATAGATGAGCAG
AGGGAAGTTGTTGGAACCACAGTTATTGTTCGCGAGCTTTTTTACAATCAACCTGTACGC
AGGAAACAAATGCAATCTAGTTACAAAAGAGAACTACATCTTGTGAAGAAGTCTGTTCTG
CGAGTTGCACTCATTCATCCACAAGTTTCACTCAGACTTTTTGATATTGAGAGTGAAGAT
GAGTTGCTATACACGATTCCTTCATCCTCCCCCTTGCCTCTTGTATCAAACATTTTGGGG
AAAAATGTCTCCAGCTGTCTTCATGAGATAGCTACCTCTGACAAGCATTTTGCTCTTTCA
GGGCACATCTCCAGACCAACAGATGTGTTCTGTAATAAGGATTTCCAGTACTTGTGTATC
CTACAATCCAGTTCTTCACTGTCTATTTCCATAGTTTCACATACCATTTTTCTGAAAGCT
TGA

Protein

280 aa

>Os09t0551900-01 Hypothetical conserved gene.
MQTIKRLPKSVHSSLRSSIVLFDLSRVVEELVYNSIDANASKIDISVNARACYVKVEDDG
CGITRDELVLVGEKYATSKFHNVMVDGEPSSRSFGLNGEALASLSDISVVEVRTKARGRP
NSYCKIIKGSKCSHLGIDEQREVVGTTVIVRELFYNQPVRRKQMQSSYKRELHLVKKSVL
RVALIHPQVSLRLFDIESEDELLYTIPSSSPLPLVSNILGKNVSSCLHEIATSDKHFALS
GHISRPTDVFCNKDFQYLCILQSSSSLSISIVSHTIFLKA*

5'UTR

chr09:21877477..21877768 (- strand) : 292 bp

chr09:21876923..21876931 (- strand) : 9 bp

CDS

chr09:21876797..21876922 (- strand) : 126 bp

chr09:21876662..21876713 (- strand) : 52 bp

chr09:21876523..21876570 (- strand) : 48 bp

chr09:21875603..21875760 (- strand) : 158 bp

chr09:21875456..21875513 (- strand) : 58 bp

chr09:21875265..21875322 (- strand) : 58 bp

chr09:21875072..21875164 (- strand) : 93 bp

chr09:21874817..21874982 (- strand) : 166 bp

chr09:21874651..21874734 (- strand) : 84 bp

3'UTR

chr09:21874405..21874650 (- strand) : 246 bp

chr09:21874103..21874181 (- strand) : 79 bp

chr09:21873953..21873997 (- strand) : 45 bp

chr09:21872468..21873871 (- strand) : 1404 bp

chr09:21872293..21872386 (- strand) : 94 bp

chr09:21871808..21872190 (- strand) : 383 bp

chr09:21871112..21871156 (- strand) : 45 bp

chr09:21870980..21871033 (- strand) : 54 bp

chr09:21870721..21870824 (- strand) : 104 bp

chr09:21870280..21870328 (- strand) : 49 bp

chr09:21869660..21869719 (- strand) : 60 bp

chr09:21869358..21869430 (- strand) : 73 bp

chr09:21869184..21869269 (- strand) : 86 bp

chr09:21868631..21869048 (- strand) : 418 bp

FASTA

>Os09t0551900-01 class=Sequence position=chr09:21868631..21877768 (- strand)
AGTGTCATTT GCCCGCCTCA CCTGCACTCT CTCCATCTCT CTCCTCCGGC GAAGGCGCGG CGCGGCGGCG TTCTCCCCCC
GCCTCGCCTC CTCCTCCTCG CGCGCGCGGC CGCGGCGAGC CAGGCTCGGA GGCGGCGGCG TTGACGGGAC GGGCTCCTCT
CCTCTCCTCC CCGACCACAC CCTACCTTCG CCCCCGCGCT GCCTCCTCGC GCGCACGGCC GGGAGACAAG CCAGGGGCGA
CGCGGCCGGC CTCGCTCCGC TCGGCTCCAT CTCGGTTCCA GTCGAATTGG AGGTATCCAT TCTCCCTCTC TCAGTCTCTC
TCCTGCTGCC TCGCGCCACC TCATGAGCCG GCGTCCGCCT CTGATGCTGC GGATTCTGAA ATTTTTGGTT TACACTGGTG
TCCAATTCTT CAATCTCAAG TTGGGGTTTA ATACCCGACC ACCCAAACCT AGACCGAAGG GTAGATGCAG GATCGTACTA
GAGATTGTTG AGTTGCTGCA GAATTTAACT TCTGGATAGG TAGGTAGTTT GTGCAGTTTG GAAGAGGGGA TGGACATTTT
TGGGCATGGG TTACGTTAGT TGTTTGTCCT AGGGGGAAAC TGATCGTTTG TTGGGTTCGT GGTGGCTACT CCATCAATGT
AAGTGGAAGG ATACTGTGGC TTCTTACTTC TATTATGTTC ATGGTGCCTG CTCATTTGAT CTGACATCAT GTTCACTTCT
TCAAGCAACC TATCTAAGTG TACATTTGAA GTTTCTGGAA GAAACTTCTG ATCTTGTCTA CTGTTTTTCT TGGATAAGTT
TCGCTGCCAA CAGTTGCTGA TTGTACTATT CCCCCAGAAT GCTTAAATGC AGACAATAAA ACGGTTGCCA AAAAGTGTCC
ATAGCTCGTT GCGCTCAAGC ATTGTTCTAT TTGACCTATC AAGGGTTGTT GAGGAGCTGG TATATAATAG CATTGACGCA
AATGCGAGCA AGGTATTACT TTCACATACA AAAAGGCAAA CTATTATGCA TGCAGTATCT TCAGTGACAT AAGTTTTCTT
TTTGATTCAT TTCAGATTGA CATCTCAGTG AATGCCAGAG CATGTTATGT TAAAGTGGAA GATGATGGTA TGCCTTTATA
GCTTTGTACC TTATGTTTTA AATTTCTTAC TGCTGGTATT TGCTTTTAGA ATAGTGTTTC CTGTTGCAAC TATTGCAGGC
TGTGGTATTA CTCGTGACGA ACTGGTTCTT GTAGGAGAAA AATATGGTAA GTTAAAACTT CTACTATTAT TTATACATTT
TCGTTTACTC CCTATACTCA AAACTGCTGT TTTTGTCATA TTAAACAATG AGGGTGCATT GTTGCAAGCT CCTTCACTTG
TTGAAGCAGG CCTTATGGAT GCTTATCTGA TTTCTCTAAT GTCAGAATAG AATTATTATC TTACAGAAAA GAAAAGGTGA
ATACATGATT TGCTTAGAAT TAGATAGTAA TAATGGAAAC AGTATCATTC TGTGATATTT GACATCGATT ATTGATATTG
AAAGCAGATG TGTTTATTAC TATTTTTTAT CATCAGATGT TTTTATTGTT ATTCGTATAG ATTGATGGTT GGTAAATGAA
ATCACTGTGT TGTTTTTGCT GCTGATGTCA CCCAGTGATG CTTTATGCAA ATCATCATTA GGTGCATAAG GATTTCAAGA
CAATATATCT TTGATTTCTC ACTTATGGGT CATGAGAAGT TAGTTGCATT AATACCTGTT GGCAGGTGTG AATTTACTAT
TTTGTTTATT ATGCTTATTC ACCGTTTCTT TGCAACCAAA TATATTTTGA TGTGCTGTCC TCAGGGTAAA AAAGAATTAG
TTGTCAGTGG GTAGGATTAT AGAAACCCCT TTATTTAAAC TTTTGTATCT TGTTAGATTC ATTCTTTTTT AAGACGTGTT
AAATGTATAT CCACCACCTT AATTACAGTA ACCATTCACT CTTGTTTTCA ATGCGCTAAT AATGTATAAC TCTTTTATTC
CATAACAGCA ACATCCAAGT TTCATAATGT CATGGTTGAT GGGGAACCTA GTTCCAGAAG TTTTGGATTA AATGGCGAAG
CACTCGCATC ACTATCTGAT ATCTCTGTTG TTGAAGTCAG GACAAAAGCT CGCGGGCGAC CAAATTCATA TTGCAAGATA
ATAAAGGTAG TTTACACACT TAACCTTTTA AAAGCTCAGC ATAATCTTGA TACATACATC CATAGCGTAT CTGAATTCTT
CTGGCAAATA TACAGGGATC CAAATGCTCA CACCTGGGAA TAGATGAGCA GAGGGAAGTT GTTGGAACCA CAGGTACATT
TTTACTCTAC ATTTAAAGAT CAAGAAAATA AAATTTTACT CTAGTCGTGT ATTCATGTGT GGTATATTTA CATTTTTTGC
CATGTTATAT AAGCTACGTA TCGTAATGTT TTTCATTTTT GTGTAGTTAT TGTTCGCGAG CTTTTTTACA ATCAACCTGT
ACGCAGGAAA CAAATGCAAT CTAGGTAAAT CATGTTATCT TTTTCATCTG TACATGTTTC TTACAATTCA CAATTTTGTT
GGAAAGAAGA TTTGATTGTC TTTCTCAACA TTATGTTTTT GTAGTTACAA AAGAGAACTA CATCTTGTGA AGAAGTCTGT
TCTGCGAGTT GCACTCATTC ATCCACAAGT TTCACTCAGA CTTTTTGATA TTGAGAGGTA GTCTATTGTG CTACACTAGC
CATTTTTATT TTACCAATAC CGCGTGAGAA AGTGTATCTA TTGACATATC TTTTTTATGT ATGTAGTGAA GATGAGTTGC
TATACACGAT TCCTTCATCC TCCCCCTTGC CTCTTGTATC AAACATTTTG GGGAAAAATG TCTCCAGCTG TCTTCATGAG
ATAGCTACCT CTGACAAGCA TTTTGCTCTT TCAGGGCACA TCTCCAGACC AACAGATGTG TTCTGTAATA AGGTAACATT
TATCATATAA GTTGTGGGTT GTTGAACAAA AGTTTGGCAA CATGTATTCA GCAAAGTGTG TTTTTCCTCT GTAGGATTTC
CAGTACTTGT GTATCCTACA ATCCAGTTCT TCACTGTCTA TTTCCATAGT TTCACATACC ATTTTTCTGA AAGCTTGAGT
TGGGAGATAT CCTTGACTTT CCAAAGATAT CAACTCAAGA TTCGTCAGTA AAAGCCCAAT CCACAATATG CTCAATAACC
TGGCATCTAG TTTTCAATCT TCTGCAAGGA ATGAGGAAAT TGATGTTCGG AGTAAGAAGA GGCAGAAGAA TGAAGTCTAC
CCTGCATATC TGCTAAACTT GTGCTGTCCT AGATCAAGCT ATGATCTACA TTTTGAGCCT TCACAGACTA TTGTGGAATT
CAAGGTGATC CATTACACAT TTATGCTTTT TAATTCCCCT TCTTTTTCTG GTAAAGCTTC ATATGTAAAC AACTGACCGG
ATAAAAGTGG TTTGGGCTTT TTTTTTTTTT TGGGGGGGGG GGCATGTTGA TTTGTACCTT CATTTCTATT TATTTTAAAA
GCAAATTTTC TTTCTTATAG CTTGACATTC ATTTCCCATT CTTTTTTATG GTTTTTCTAC TCTTTAGGAT TGGCAAACTG
TCATGTATTT CTTTGAACGA ACTATCACAG ACTATTGGAA GAAGCATGCA CCTCAACTGC CAGAAGGTTA GAAAAATATT
TACTTCCGTA ATGATGTCTT CCCTGAACAA TTTTGAAGTC TAGAAGCTGT TGATTGAATG ATTTTCTTAT TGTTATCCTT
TTCTATTGTA GTGAAAGCTA TTGGCAATGA TACCTGTGTG CCTTTGGAAA GAGATGGTCA GTGATTTAGT GTACACGATT
CTCTTCCTCT TTTGATTCGT CTGCCTTGTG AGCTTTGTGC ACGTGTTGTT TTTGCAGTGA AATCAAGTCA GGAACTGTTA
AGGCGTCATG GTGTGCAGAA GAAAGAAGAT GTCGCTGAAT TGTACCAAAC AGCTCTGCAG AAGAATACAG TACGAGACAT
GAATTTTGAT ACAGCTGCCC CAGCAGAACC TAAAGACAAT TACCTTTCTT TGGATATGGA GCCATCCACA TGGCGTGCCT
GCTATGACCA GATCAGTGAT GCATCCCACA CAGATGATGT TGCTAGGAAT GGTCGGAAAT TTGGTCATAA GCAAATATGT
TCCCTTCAAA GTTATAGTTA TCAGTGGTTA GAGGACGGCT CTTCCCTGTT AGAAGACTCT GATCTTTCAA GTGCTAACCC
AACTATTTGT AAAATGCAAA AGACAGAAGA TATATTCCAT GGGCATGCAT ATTCTGGTAA GTTTGGACTG CTACAAGATG
CAGAAATCGA AATCGGTCCA GAAATTAAAC TCCAAGAATA TTGCTTTGAA TCTCCCAATA AACCGAACAG AATGACCTGC
GATTTTGTGC AAAAGCAAAC CAATATAGAG GCACACATTT CAGGCCGTGA TGGATTCTAT GTTGATTTTG ATAAATTGAA
CGAGGACTGT CTACTCAATG AGATATCAAA GACAATCACT GATGTTTCCT GCCCTCAAAT GCCACACTTT AATGATGGAC
TCTGTCCTGA GGACGTTGGC TCCTCCAAGA GTTCCTGTAG TGTCAGGAAA AAGTCTAGTA AAAGGCAAAA TAGTGCTAAT
GCAATTGCCC AGATGAAGTT CCATGATATG CAAGCAGTTT GCGAAAGTGA TTACATGGAT AGGTCCTTCA TCAAGGATAC
ATGTGGCCTT CATTTCTTTC ATCCATTCTC GTTGGCTGAT ACACCTCGCA GTCACAGTCG TGCAAGGATT GACTTGGAAT
TGCATGGAAG GTCAAATGAA AGCATTAACA GTTGGAACTG TGAAAATATT GGCACTGATT TTGGATTTAC TTCAGACAGG
TTTAATATTG ATTCATCAAT GATTTTTGAA GGAAGCAAAC ATCTCAATAA CTTTGGCAAT GGAACTCAAT CTCCTAGTTA
CTTCAATCAT GAATATTGTT CTGTCGGTCA GTTTGCTTCC AAACAGGATC GGATACCCTT GAAATCAAAA CATGATGCAA
GAATGTCATA TGATATTTCT CCTGAGAAAA GTTCTACTGG TTGTCATTTG AATGTTTCTT TTTCCCAAGT GGCAAAAAGC
AGCAAGCTTA CTGAAGATCA GTATGGATGC AGTCAGAGGC CCAGGCTTTC CAGAGGTAGA TATAGGAGTC GTTCTGCACC
ACCATTTTAC AGAGGCAAAA GAAAATTCCC TAGATTAAAC GAACCACTAA CCAAATTGAC TACAGAAGGT GGTAAATATA
CCACTGTTAA TGACTCAGGA GGTACGTCTT CTCAGAGCCA TGGCAAATCT TTATACTGCT CTGTCATGAG CAATAAGTTT
GTATCTTTTA TACTGGATGC AGATATCACA CCTGTTCAGG AGTATACATC ACATATGAAC GCAACCCAAC CTATTCCTGA
GACCTTTAGC AATGACTTTT CTGACCTAAA TTTCAGGTAT GCTTCTTTTG CATGTTGCCA TACTACTGAG AATGTCTTAC
TCTTTTTTTA TTTTTTCATA AACCTCTTAC TATGTACTTA TTTTTGCCAT TTTCTTAGCT TGAAGGGAAA TGTCAAAATG
TGCGAAGAGA AATGTTCTGA TGAACTCGAA GATTCTACTG CTTCAGATGA AATAACAAAA TGGCGTGATG ACTCTGACCA
TCATGCAGTT GAGCATTTTG TGCCAAGAGT TATATCACTG TGCACAATTT TCTATGCTCA TATTTTATCT CTCTGTGTAG
GTTTCGGAGT TGCAACATGG TCCTTTTGAA CACGATGATG ATGTACTTAG CATTTCTTAT GGGCCCTTAC ACCTCTCATG
CAGTGTTCTA GTTCCTGAAT GTATTGATAA AAATTGCTTT GAGGAGGCAA GAGTTTTGTT GCAGCTGGAT AAGAAATTTA
TTCCTGTCAT ATCTGGGGAA GTACTACTCC TTGTTGATCA GGTCTGTAGT CAAGTATGTC ATTTGTGGAA AAAAGTTAAA
TTTAGGAGTA Ttctctccat tcaaaagtct taagacatat ttcatttttt ggtttttcca aaagtctaag gcctatttgt
aatctctatg tgctaaatta aattgttgac cggaacacaa gaagccatct tagtacttat tggttgcatg catgtgtata
cttcattggt tttgtcacat ggtggatgag ttaattactc cttgatcttt gtgacaaaag aaataggtct tagacttttt
ggatggaggg agtaTTATTT AGCAGTTTGT TTATATTGTT TTGTGGTAAT AGTCATGTTG TGGAGATGAA TTCTGTTGGA
TTGCTTGTTG CATTTGATGA CCGCGATACA ATACACTACT TTTTTTTCTT ACTGTTTAGA ATTGACTAGT CATAGGAGAT
GTTTGACCTT TATGTATATG ATGCTTGAGC GCATAAAATG TTTGAAATAT ATGCAGGATA CCAGAAACTT GTTGGATTTT
TTCTTTCTTT AAGCAGGAAG AATTCATTTT TTATGTTCAC ATACTATATG AAGTAGTCAG TGTGTATATG GTGACAAAGG
TACTTCTCGG ACAGATTTTA GTAACTTACT CCTTGTTCTT ACTATTTTAC AGCATGCAGC TGATGAAAGG ATACGTTTGG
AGGAACTCCG TCGAAAGGTT GTTTAACTTA AATTGACCAG GAATGTTCAT AACATTGTTT CCCCTCTTTC ATATTCACTT
TGTTTGGATT TACAGGTTTT ATCAGATGAT GGCAGAGGGA TTACTTACTT GGACTCTGAG GAGGACTTAG TACGTCACTT
TATACTTTAT AGCAGTTGGC ATCTGCTGCA CTGTGTTAAT AGCTTAATAT AATATATCTA AGAGAATTAT TTTGAGATTA
AGATAAGTTT TCTTTGAACA CTAGGATGTG TTGTTTGATC TTCTATCATC TATTTATTTG CCAGGTTCTC CCTGAGACTG
GATTTCAATT GTTCCAAAAG TATATGCAAC AGATCCAAAG TTGGGGCTGG ATCATCAACA GTACTAATTC CTGTGAATCA
TTCAAAAAGT AGGTGCCTGA CAATCATGTG AATGAAAAAC TTTCTTTTGT GTACTTAGCC TTCGGTGCTA TTTTATCGAG
GTCTTCTTGC ACATCTTCTA GTTATGTTCA TTTGAATCTA CTTCTGTAAT TAAGACAATC TGAGCCTTCT AGTGCTGTTT
AGGTTGCACA ATTTTAGTTT GTGTTTATCA TACCTTCAGC TTCTTATAGT ATAAGAATAG TCAGTTCAGA AGGTCACATG
AATTTCTTCA ATTAACATTT GGTGATAACA TGTTATGATG CTTTTGGATG GCTCAGTCCA TCATTCTCTA CCCATTGTGA
AGGAGCAAAA AGCTGTTTAT CCCCTCTGTA TACACTAGAA TATAATAATT GACACATACC ATTTACTTTA TATTTTAAAG
GAACATGAAC GTTCTGAGGA GACAATCGCG CCGTCTTACT CTTGCTGCTG TGAGTAACCT TTTCTGCGAC CCACATATAT
TCAACCTCTC TGCAATAGCT ACTTATCGTA CCACCCCTGC AATCTGTCTA GGTGGTGTGT TGCTTTGTAC CTGTGTTGGT
TATATGCTTA TTTCTATGGT AAAAGTTAGT TTGATAACTT TGATATCCAT GAAATGTCCG AAAGTGTTTC AAAAGAATAT
AGACAAGCTT CAAACACTAT ATTTCTTTGA AACCTTCAGG CCATGCTACG TTTCTTAAAA ATAAGGGAAA AAAATATTTA
ATAAGGGATA CTTGTTCTCA TTGAGTCTGG TAATTAGCTG TTTTTTATGC AATTTGCTAT CTGTAGCCAT TTATGTTGTA
GTGATCTAGT TAATCATTGT GTACATTTTT TTTTGTTACT GCTATTTGAA GCGCAAATAT TATCAGGAGT GGCTGTGGAT
ATGCAATTGT CTTTTTTATA TCTTGTTTTT CTATGCATAT TATCCTAATG CTGTTACAAA TATCTGGCGA AATTTTCTCA
GAAAATTTGC AACACATGTT ATAGTGCCCT CATCATGTAC CCTGCACAGG TTCCATGTAT TTTGGGCGTC ACTTTAACAG
GAAAAGATCT TATGGACTTC ATTCAGCAGG TGATTTATTC TGCTACACTT CATTTTAAGT TATGAAACTC ATCAATTTAG
GTCAACATTA GTCAAATTGT TTGGATGTGT AATGCTTTTT CTTGACAGTG TATTTGTACA CCGTTAGATG TAGGTCCCGT
GTCTTAGAAA ATGCTAGTTC GGAAGGAAGA TAAAACTGCA GGGAAATGAT TTGTTATTCT AACTGCAGAG TTTTCTTATG
CATTGCTATT TTTTCCAGCT TGATGACACA GATGGGTCGT CAGCTATCCC CCCAGCGGTC ATTCGTATTC TCAATTTCAA
GGCTTGCAGA GGTACACCTT GTATCTCTCC CCTTTTGTTC AAAAGTTTTC ACCTCGACTC AAAAGCGACG CCCTGATGTT
TGTTCTTGGT TGACCTTAGG TGCGATCATG TTTGGCGATC CTCTGCTACC ATCGGAGTGC TCTCTGATTA TCGAAGAACT
GAAAGCAACA TCTTTATGTT TCCAGGTACC ATCGAAATGC TACAATTTCC AGATCTTATT CTTACTGTTA TCTAAGCCAT
TGGTTTACTG ATGAAAGCTC CATTAATAAA CCATTAGTAG TGTCTAATCA AGGTTTTTCT TTGTTTTTTT TTCCTGGCAG
TGTGCTCATG GACGTCCGAC CACCGTGCCG ATTGTGAACG TCGCATCTCT CCGCGGCGAG TTGGCGAGGC TCGGAGCGGT
GAACGGAAGG CAAGAAGAGA CCTGGCATGG TCTCTCGCAC CATGGACCCA GCCTTGAACG TGCTCGAACG CGCCTCAGAG
AACTGAGAAA GCTACGTGGT GGCCTGTAGC TGTACAACAG TACAAGATGT AGGATCATAT AGAGGGTAAA TAGTCCAAAA
GAAAAGGAGA AGTGTTGCAT AGTGCTTCAA TAGGAAGCGG CTTTGTAGTT TGCAGAGATA GATATGCCAT TGGTTCACGA
AGAAGAGGTA AAATGGCCAT GAGCCGTGTT GTACACTTGT AAACCATTGT GATTTGTGAA GGCCATTCTC ACCCTGTAAA
TATATGACAA TATTTTTC

Locus: Os09g0551900

Loading...

Locus: Os09g0551900

Loading...