Os09t0551900-02

Locus

Os09g0551900

Description

MutL-homolog 3 protein, MLH3-like DNA mismatch repair protein, Formation of type I crossovers during meiosis, Regulation of embryo sac fertility

RAP-DB Gene Symbol Synonym(s)

OsMLH3, FSV1

RAP-DB Gene Name Synonym(s)

MutL-homolog 3, female sterile variation 1

CGSNL Gene Symbol

FSV1

CGSNL Gene Name

FEMALE STERILE VARIATION 1

Oryzabase Gene Symbol Synonym(s)

OsFSV1, OsMLH3, MLH3

Oryzabase Gene Name Synonym(s)

MutL-homolog 3, female sterile variation 1

Transcript Evidence

XM_015757027

Inferred from literature

Protein Evidence

XP_015612513 (RefSeq)

Literature

PMID: 33544956

Note

Manual Curation

February 8, 2021

Gene Ontology (GO)

Biological Process: mismatch repair (GO:0006298)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: mismatched DNA binding (GO:0030983)

Functional domain (InterPro)

Histidine kinase/HSP90-like ATPase superfamily (IPR036890)

Ribosomal protein S5 domain 2-type fold (IPR020568)

Ribosomal protein S5 domain 2-type fold, subgroup (IPR014721)

MutL, C-terminal domain superfamily (IPR037198)

MutL, C-terminal domain, dimerisation subdomain (IPR042120)

MutL, C-terminal domain, regulatory subdomain (IPR042121)

DNA mismatch repair protein, S5 domain 2-like (IPR013507)

MutL, C-terminal, dimerisation (IPR014790)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Others

Oryzabase (23965)

Transcript

4195 bp

>Os09t0551900-02 MutL-homolog 3 protein, MLH3-like DNA mismatch repair protein, Formation of type I crossovers during meiosis, Regulation of embryo sac fertility
TCTCCTTAGCGACGACGAGGCGGCGGGCGGCCACTCTCCAGTGTCATTTGCCCGCCTCAC
CTGCACTCTCTCCATCTCTCTCCTCCGGCGAAGGCGCGGCGCGGCGGCGTTCTCCCCCCG
CCTCGCCTCCTCCTCCTCGCGCGCGCGGCCGCGGCGAGCCAGGCTCGGAGGCGGCGGCGT
TGACGGGACGGGCTCCTCTCCTCTCCTCCCCGACCACACCCTACCTTCGCCCCCGCGCTG
CCTCCTCGCGCGCACGGCCGGGAGACAAGCCAGGGGCGACGCGGCCGGCCTCGCTCCGCT
CGGCTCCATCTCGGTTCCAGTCGAATTGGAGAATGCTTAAATGCAGACAATAAAACGGTT
GCCAAAAAGTGTCCATAGCTCGTTGCGCTCAAGCATTGTTCTATTTGACCTATCAAGGGT
TGTTGAGGAGCTGGTATATAATAGCATTGACGCAAATGCGAGCAAGATTGACATCTCAGT
GAATGCCAGAGCATGTTATGTTAAAGTGGAAGATGATGGCTGTGGTATTACTCGTGACGA
ACTGGTTCTTGTAGGAGAAAAATATGCAACATCCAAGTTTCATAATGTCATGGTTGATGG
GGAACCTAGTTCCAGAAGTTTTGGATTAAATGGCGAAGCACTCGCATCACTATCTGATAT
CTCTGTTGTTGAAGTCAGGACAAAAGCTCGCGGGCGACCAAATTCATATTGCAAGATAAT
AAAGGGATCCAAATGCTCACACCTGGGAATAGATGAGCAGAGGGAAGTTGTTGGAACCAC
AGTTATTGTTCGCGAGCTTTTTTACAATCAACCTGTACGCAGGAAACAAATGCAATCTAG
TTACAAAAGAGAACTACATCTTGTGAAGAAGTCTGTTCTGCGAGTTGCACTCATTCATCC
ACAAGTTTCACTCAGACTTTTTGATATTGAGAGTGAAGATGAGTTGCTATACACGATTCC
TTCATCCTCCCCCTTGCCTCTTGTATCAAACATTTTGGGGAAAAATGTCTCCAGCTGTCT
TCATGAGATAGCTACCTCTGACAAGCATTTTGCTCTTTCAGGGCACATCTCCAGACCAAC
AGATGTGTTCTGTAATAAGGATTTCCAGTACTTGTATATCAACTCAAGATTCGTCAGTAA
AAGCCCAATCCACAATATGCTCAATAACCTGGCATCTAGTTTTCAATCTTCTGCAAGGAA
TGAGGAAATTGATGTTCGGAGTAAGAAGAGGCAGAAGAATGAAGTCTACCCTGCATATCT
GCTAAACTTGTGCTGTCCTAGATCAAGCTATGATCTACATTTTGAGCCTTCACAGACTAT
TGTGGAATTCAAGGATTGGCAAACTGTCATGTATTTCTTTGAACGAACTATCACAGACTA
TTGGAAGAAGCATGCACCTCAACTGCCAGAAGTGAAAGCTATTGGCAATGATACCTGTGT
GCCTTTGGAAAGAGATGTGAAATCAAGTCAGGAACTGTTAAGGCGTCATGGTGTGCAGAA
GAAAGAAGATGTCGCTGAATTGTACCAAACAGCTCTGCAGAAGAATACAGTACGAGACAT
GAATTTTGATACAGCTGCCCCAGCAGAACCTAAAGACAATTACCTTTCTTTGGATATGGA
GCCATCCACATGGCGTGCCTGCTATGACCAGATCAGTGATGCATCCCACACAGATGATGT
TGCTAGGAATGGTCGGAAATTTGGTCATAAGCAAATATGTTCCCTTCAAAGTTATAGTTA
TCAGTGGTTAGAGGACGGCTCTTCCCTGTTAGAAGACTCTGATCTTTCAAGTGCTAACCC
AACTATTTGTAAAATGCAAAAGACAGAAGATATATTCCATGGGCATGCATATTCTGGTAA
GTTTGGACTGCTACAAGATGCAGAAATCGAAATCGGTCCAGAAATTAAACTCCAAGAATA
TTGCTTTGAATCTCCCAATAAACCGAACAGAATGACCTGCGATTTTGTGCAAAAGCAAAC
CAATATAGAGGCACACATTTCAGGCCGTGATGGATTCTATGTTGATTTTGATAAATTGAA
CGAGGACTGTCTACTCAATGAGATATCAAAGACAATCACTGATGTTTCCTGCCCTCAAAT
GCCACACTTTAATGATGGACTCTGTCCTGAGGACGTTGGCTCCTCCAAGAGTTCCTGTAG
TGTCAGGAAAAAGTCTAGTAAAAGGCAAAATAGTGCTAATGCAATTGCCCAGATGAAGTT
CCATGATATGCAAGCAGTTTGCGAAAGTGATTACATGGATAGGTCCTTCATCAAGGATAC
ATGTGGCCTTCATTTCTTTCATCCATTCTCGTTGGCTGATACACCTCGCAGTCACAGTCG
TGCAAGGATTGACTTGGAATTGCATGGAAGGTCAAATGAAAGCATTAACAGTTGGAACTG
TGAAAATATTGGCACTGATTTTGGATTTACTTCAGACAGGTTTAATATTGATTCATCAAT
GATTTTTGAAGGAAGCAAACATCTCAATAACTTTGGCAATGGAACTCAATCTCCTAGTTA
CTTCAATCATGAATATTGTTCTGTCGGTCAGTTTGCTTCCAAACAGGATCGGATACCCTT
GAAATCAAAACATGATGCAAGAATGTCATATGATATTTCTCCTGAGAAAAGTTCTACTGG
TTGTCATTTGAATGTTTCTTTTTCCCAAGTGGCAAAAAGCAGCAAGCTTACTGAAGATCA
GTATGGATGCAGTCAGAGGCCCAGGCTTTCCAGAGGTAGATATAGGAGTCGTTCTGCACC
ACCATTTTACAGAGGCAAAAGAAAATTCCCTAGATTAAACGAACCACTAACCAAATTGAC
TACAGAAGGTGGTAAATATACCACTGTTAATGACTCAGGAGATATCACACCTGTTCAGGA
GTATACATCACATATGAACGCAACCCAACCTATTCCTGAGACCTTTAGCAATGACTTTTC
TGACCTAAATTTCAGCTTGAAGGGAAATGTCAAAATGTGCGAAGAGAAATGTTCTGATGA
ACTCGAAGATTCTACTGCTTCAGATGAAATAACAAAATGGCGTGATGACTCTGACCATCA
TGCAGTTTCGGAGTTGCAACATGGTCCTTTTGAACACGATGATGATGTACTTAGCATTTC
TTATGGGCCCTTACACCTCTCATGCAGTGTTCTAGTTCCTGAATGTATTGATAAAAATTG
CTTTGAGGAGGCAAGAGTTTTGTTGCAGCTGGATAAGAAATTTATTCCTGTCATATCTGG
GGAAGTACTACTCCTTGTTGATCAGCATGCAGCTGATGAAAGGATACGTTTGGAGGAACT
CCGTCGAAAGGTTTTATCAGATGATGGCAGAGGGATTACTTACTTGGACTCTGAGGAGGA
CTTAGTTCTCCCTGAGACTGGATTTCAATTGTTCCAAAAGTATATGCAACAGATCCAAAG
TTGGGGCTGGATCATCAACAGTACTAATTCCTGTGAATCATTCAAAAAGAACATGAACGT
TCTGAGGAGACAATCGCGCCGTCTTACTCTTGCTGCTGTTCCATGTATTTTGGGCGTCAC
TTTAACAGGAAAAGATCTTATGGACTTCATTCAGCAGCTTGATGACACAGATGGGTCGTC
AGCTATCCCCCCAGCGGTCATTCGTATTCTCAATTTCAAGGCTTGCAGAGGTGCGATCAT
GTTTGGCGATCCTCTGCTACCATCGGAGTGCTCTCTGATTATCGAAGAACTGAAAGCAAC
ATCTTTATGTTTCCAGTGTGCTCATGGACGTCCGACCACCGTGCCGATTGTGAACGTCGC
ATCTCTCCGCGGCGAGTTGGCGAGGCTCGGAGCGGTGAACGGAAGGCAAGAAGAGACCTG
GCATGGTCTCTCGCACCATGGACCCAGCCTTGAACGTGCTCGAACGCGCCTCAGAGAACT
GAGAAAGCTACGTGGTGGCCTGTAGCTGTACAACAGTACAAGATGTAGGATCATATAGAG
GGTAAATAGTCCAAAAGAAAAGGAGAAGTGTTGCATAGTGCTTCAATAGGAAGCGGCTTT
GTAGTTTGCAGAGATAGATATGCCATTGGTTCACGAAGAAGAGGTAAAATGGCCATGAGC
CGTGTTGTACACTTGTAAACCATTGTGATTTGTGAAGGCCATTCTCACCCTGTAAATATA
TGACAATATTTTTCGCAGTTTTCAGAGCAAAAGCCAAGTCCGGCTCTCTTTTTTT

CDS

3585 bp

>Os09t0551900-02 MutL-homolog 3 protein, MLH3-like DNA mismatch repair protein, Formation of type I crossovers during meiosis, Regulation of embryo sac fertility
ATGCAGACAATAAAACGGTTGCCAAAAAGTGTCCATAGCTCGTTGCGCTCAAGCATTGTT
CTATTTGACCTATCAAGGGTTGTTGAGGAGCTGGTATATAATAGCATTGACGCAAATGCG
AGCAAGATTGACATCTCAGTGAATGCCAGAGCATGTTATGTTAAAGTGGAAGATGATGGC
TGTGGTATTACTCGTGACGAACTGGTTCTTGTAGGAGAAAAATATGCAACATCCAAGTTT
CATAATGTCATGGTTGATGGGGAACCTAGTTCCAGAAGTTTTGGATTAAATGGCGAAGCA
CTCGCATCACTATCTGATATCTCTGTTGTTGAAGTCAGGACAAAAGCTCGCGGGCGACCA
AATTCATATTGCAAGATAATAAAGGGATCCAAATGCTCACACCTGGGAATAGATGAGCAG
AGGGAAGTTGTTGGAACCACAGTTATTGTTCGCGAGCTTTTTTACAATCAACCTGTACGC
AGGAAACAAATGCAATCTAGTTACAAAAGAGAACTACATCTTGTGAAGAAGTCTGTTCTG
CGAGTTGCACTCATTCATCCACAAGTTTCACTCAGACTTTTTGATATTGAGAGTGAAGAT
GAGTTGCTATACACGATTCCTTCATCCTCCCCCTTGCCTCTTGTATCAAACATTTTGGGG
AAAAATGTCTCCAGCTGTCTTCATGAGATAGCTACCTCTGACAAGCATTTTGCTCTTTCA
GGGCACATCTCCAGACCAACAGATGTGTTCTGTAATAAGGATTTCCAGTACTTGTATATC
AACTCAAGATTCGTCAGTAAAAGCCCAATCCACAATATGCTCAATAACCTGGCATCTAGT
TTTCAATCTTCTGCAAGGAATGAGGAAATTGATGTTCGGAGTAAGAAGAGGCAGAAGAAT
GAAGTCTACCCTGCATATCTGCTAAACTTGTGCTGTCCTAGATCAAGCTATGATCTACAT
TTTGAGCCTTCACAGACTATTGTGGAATTCAAGGATTGGCAAACTGTCATGTATTTCTTT
GAACGAACTATCACAGACTATTGGAAGAAGCATGCACCTCAACTGCCAGAAGTGAAAGCT
ATTGGCAATGATACCTGTGTGCCTTTGGAAAGAGATGTGAAATCAAGTCAGGAACTGTTA
AGGCGTCATGGTGTGCAGAAGAAAGAAGATGTCGCTGAATTGTACCAAACAGCTCTGCAG
AAGAATACAGTACGAGACATGAATTTTGATACAGCTGCCCCAGCAGAACCTAAAGACAAT
TACCTTTCTTTGGATATGGAGCCATCCACATGGCGTGCCTGCTATGACCAGATCAGTGAT
GCATCCCACACAGATGATGTTGCTAGGAATGGTCGGAAATTTGGTCATAAGCAAATATGT
TCCCTTCAAAGTTATAGTTATCAGTGGTTAGAGGACGGCTCTTCCCTGTTAGAAGACTCT
GATCTTTCAAGTGCTAACCCAACTATTTGTAAAATGCAAAAGACAGAAGATATATTCCAT
GGGCATGCATATTCTGGTAAGTTTGGACTGCTACAAGATGCAGAAATCGAAATCGGTCCA
GAAATTAAACTCCAAGAATATTGCTTTGAATCTCCCAATAAACCGAACAGAATGACCTGC
GATTTTGTGCAAAAGCAAACCAATATAGAGGCACACATTTCAGGCCGTGATGGATTCTAT
GTTGATTTTGATAAATTGAACGAGGACTGTCTACTCAATGAGATATCAAAGACAATCACT
GATGTTTCCTGCCCTCAAATGCCACACTTTAATGATGGACTCTGTCCTGAGGACGTTGGC
TCCTCCAAGAGTTCCTGTAGTGTCAGGAAAAAGTCTAGTAAAAGGCAAAATAGTGCTAAT
GCAATTGCCCAGATGAAGTTCCATGATATGCAAGCAGTTTGCGAAAGTGATTACATGGAT
AGGTCCTTCATCAAGGATACATGTGGCCTTCATTTCTTTCATCCATTCTCGTTGGCTGAT
ACACCTCGCAGTCACAGTCGTGCAAGGATTGACTTGGAATTGCATGGAAGGTCAAATGAA
AGCATTAACAGTTGGAACTGTGAAAATATTGGCACTGATTTTGGATTTACTTCAGACAGG
TTTAATATTGATTCATCAATGATTTTTGAAGGAAGCAAACATCTCAATAACTTTGGCAAT
GGAACTCAATCTCCTAGTTACTTCAATCATGAATATTGTTCTGTCGGTCAGTTTGCTTCC
AAACAGGATCGGATACCCTTGAAATCAAAACATGATGCAAGAATGTCATATGATATTTCT
CCTGAGAAAAGTTCTACTGGTTGTCATTTGAATGTTTCTTTTTCCCAAGTGGCAAAAAGC
AGCAAGCTTACTGAAGATCAGTATGGATGCAGTCAGAGGCCCAGGCTTTCCAGAGGTAGA
TATAGGAGTCGTTCTGCACCACCATTTTACAGAGGCAAAAGAAAATTCCCTAGATTAAAC
GAACCACTAACCAAATTGACTACAGAAGGTGGTAAATATACCACTGTTAATGACTCAGGA
GATATCACACCTGTTCAGGAGTATACATCACATATGAACGCAACCCAACCTATTCCTGAG
ACCTTTAGCAATGACTTTTCTGACCTAAATTTCAGCTTGAAGGGAAATGTCAAAATGTGC
GAAGAGAAATGTTCTGATGAACTCGAAGATTCTACTGCTTCAGATGAAATAACAAAATGG
CGTGATGACTCTGACCATCATGCAGTTTCGGAGTTGCAACATGGTCCTTTTGAACACGAT
GATGATGTACTTAGCATTTCTTATGGGCCCTTACACCTCTCATGCAGTGTTCTAGTTCCT
GAATGTATTGATAAAAATTGCTTTGAGGAGGCAAGAGTTTTGTTGCAGCTGGATAAGAAA
TTTATTCCTGTCATATCTGGGGAAGTACTACTCCTTGTTGATCAGCATGCAGCTGATGAA
AGGATACGTTTGGAGGAACTCCGTCGAAAGGTTTTATCAGATGATGGCAGAGGGATTACT
TACTTGGACTCTGAGGAGGACTTAGTTCTCCCTGAGACTGGATTTCAATTGTTCCAAAAG
TATATGCAACAGATCCAAAGTTGGGGCTGGATCATCAACAGTACTAATTCCTGTGAATCA
TTCAAAAAGAACATGAACGTTCTGAGGAGACAATCGCGCCGTCTTACTCTTGCTGCTGTT
CCATGTATTTTGGGCGTCACTTTAACAGGAAAAGATCTTATGGACTTCATTCAGCAGCTT
GATGACACAGATGGGTCGTCAGCTATCCCCCCAGCGGTCATTCGTATTCTCAATTTCAAG
GCTTGCAGAGGTGCGATCATGTTTGGCGATCCTCTGCTACCATCGGAGTGCTCTCTGATT
ATCGAAGAACTGAAAGCAACATCTTTATGTTTCCAGTGTGCTCATGGACGTCCGACCACC
GTGCCGATTGTGAACGTCGCATCTCTCCGCGGCGAGTTGGCGAGGCTCGGAGCGGTGAAC
GGAAGGCAAGAAGAGACCTGGCATGGTCTCTCGCACCATGGACCCAGCCTTGAACGTGCT
CGAACGCGCCTCAGAGAACTGAGAAAGCTACGTGGTGGCCTGTAG

Protein

1194 aa

>Os09t0551900-02 MutL-homolog 3 protein, MLH3-like DNA mismatch repair protein, Formation of type I crossovers during meiosis, Regulation of embryo sac fertility
MQTIKRLPKSVHSSLRSSIVLFDLSRVVEELVYNSIDANASKIDISVNARACYVKVEDDG
CGITRDELVLVGEKYATSKFHNVMVDGEPSSRSFGLNGEALASLSDISVVEVRTKARGRP
NSYCKIIKGSKCSHLGIDEQREVVGTTVIVRELFYNQPVRRKQMQSSYKRELHLVKKSVL
RVALIHPQVSLRLFDIESEDELLYTIPSSSPLPLVSNILGKNVSSCLHEIATSDKHFALS
GHISRPTDVFCNKDFQYLYINSRFVSKSPIHNMLNNLASSFQSSARNEEIDVRSKKRQKN
EVYPAYLLNLCCPRSSYDLHFEPSQTIVEFKDWQTVMYFFERTITDYWKKHAPQLPEVKA
IGNDTCVPLERDVKSSQELLRRHGVQKKEDVAELYQTALQKNTVRDMNFDTAAPAEPKDN
YLSLDMEPSTWRACYDQISDASHTDDVARNGRKFGHKQICSLQSYSYQWLEDGSSLLEDS
DLSSANPTICKMQKTEDIFHGHAYSGKFGLLQDAEIEIGPEIKLQEYCFESPNKPNRMTC
DFVQKQTNIEAHISGRDGFYVDFDKLNEDCLLNEISKTITDVSCPQMPHFNDGLCPEDVG
SSKSSCSVRKKSSKRQNSANAIAQMKFHDMQAVCESDYMDRSFIKDTCGLHFFHPFSLAD
TPRSHSRARIDLELHGRSNESINSWNCENIGTDFGFTSDRFNIDSSMIFEGSKHLNNFGN
GTQSPSYFNHEYCSVGQFASKQDRIPLKSKHDARMSYDISPEKSSTGCHLNVSFSQVAKS
SKLTEDQYGCSQRPRLSRGRYRSRSAPPFYRGKRKFPRLNEPLTKLTTEGGKYTTVNDSG
DITPVQEYTSHMNATQPIPETFSNDFSDLNFSLKGNVKMCEEKCSDELEDSTASDEITKW
RDDSDHHAVSELQHGPFEHDDDVLSISYGPLHLSCSVLVPECIDKNCFEEARVLLQLDKK
FIPVISGEVLLLVDQHAADERIRLEELRRKVLSDDGRGITYLDSEEDLVLPETGFQLFQK
YMQQIQSWGWIINSTNSCESFKKNMNVLRRQSRRLTLAAVPCILGVTLTGKDLMDFIQQL
DDTDGSSAIPPAVIRILNFKACRGAIMFGDPLLPSECSLIIEELKATSLCFQCAHGRPTT
VPIVNVASLRGELARLGAVNGRQEETWHGLSHHGPSLERARTRLRELRKLRGGL*

5'UTR

chr09:21877477..21877807 (- strand) : 331 bp

chr09:21876923..21876931 (- strand) : 9 bp

CDS

chr09:21876797..21876922 (- strand) : 126 bp

chr09:21876662..21876713 (- strand) : 52 bp

chr09:21876523..21876570 (- strand) : 48 bp

chr09:21875603..21875760 (- strand) : 158 bp

chr09:21875456..21875513 (- strand) : 58 bp

chr09:21875265..21875322 (- strand) : 58 bp

chr09:21875072..21875164 (- strand) : 93 bp

chr09:21874817..21874982 (- strand) : 166 bp

chr09:21874719..21874734 (- strand) : 16 bp

chr09:21874405..21874622 (- strand) : 218 bp

chr09:21874103..21874181 (- strand) : 79 bp

chr09:21873953..21873997 (- strand) : 45 bp

chr09:21872468..21873871 (- strand) : 1404 bp

chr09:21872293..21872386 (- strand) : 94 bp

chr09:21872082..21872190 (- strand) : 109 bp

chr09:21871808..21872008 (- strand) : 201 bp

chr09:21871112..21871156 (- strand) : 45 bp

chr09:21870980..21871033 (- strand) : 54 bp

chr09:21870721..21870824 (- strand) : 104 bp

chr09:21870280..21870328 (- strand) : 49 bp

chr09:21869660..21869719 (- strand) : 60 bp

chr09:21869358..21869430 (- strand) : 73 bp

chr09:21869184..21869269 (- strand) : 86 bp

chr09:21868860..21869048 (- strand) : 189 bp

3'UTR

chr09:21868590..21868859 (- strand) : 270 bp

FASTA

>Os09t0551900-02 class=Sequence position=chr09:21868590..21877807 (- strand)
TCTCCTTAGC GACGACGAGG CGGCGGGCGG CCACTCTCCA GTGTCATTTG CCCGCCTCAC CTGCACTCTC TCCATCTCTC
TCCTCCGGCG AAGGCGCGGC GCGGCGGCGT TCTCCCCCCG CCTCGCCTCC TCCTCCTCGC GCGCGCGGCC GCGGCGAGCC
AGGCTCGGAG GCGGCGGCGT TGACGGGACG GGCTCCTCTC CTCTCCTCCC CGACCACACC CTACCTTCGC CCCCGCGCTG
CCTCCTCGCG CGCACGGCCG GGAGACAAGC CAGGGGCGAC GCGGCCGGCC TCGCTCCGCT CGGCTCCATC TCGGTTCCAG
TCGAATTGGA GGTATCCATT CTCCCTCTCT CAGTCTCTCT CCTGCTGCCT CGCGCCACCT CATGAGCCGG CGTCCGCCTC
TGATGCTGCG GATTCTGAAA TTTTTGGTTT ACACTGGTGT CCAATTCTTC AATCTCAAGT TGGGGTTTAA TACCCGACCA
CCCAAACCTA GACCGAAGGG TAGATGCAGG ATCGTACTAG AGATTGTTGA GTTGCTGCAG AATTTAACTT CTGGATAGGT
AGGTAGTTTG TGCAGTTTGG AAGAGGGGAT GGACATTTTT GGGCATGGGT TACGTTAGTT GTTTGTCCTA GGGGGAAACT
GATCGTTTGT TGGGTTCGTG GTGGCTACTC CATCAATGTA AGTGGAAGGA TACTGTGGCT TCTTACTTCT ATTATGTTCA
TGGTGCCTGC TCATTTGATC TGACATCATG TTCACTTCTT CAAGCAACCT ATCTAAGTGT ACATTTGAAG TTTCTGGAAG
AAACTTCTGA TCTTGTCTAC TGTTTTTCTT GGATAAGTTT CGCTGCCAAC AGTTGCTGAT TGTACTATTC CCCCAGAATG
CTTAAATGCA GACAATAAAA CGGTTGCCAA AAAGTGTCCA TAGCTCGTTG CGCTCAAGCA TTGTTCTATT TGACCTATCA
AGGGTTGTTG AGGAGCTGGT ATATAATAGC ATTGACGCAA ATGCGAGCAA GGTATTACTT TCACATACAA AAAGGCAAAC
TATTATGCAT GCAGTATCTT CAGTGACATA AGTTTTCTTT TTGATTCATT TCAGATTGAC ATCTCAGTGA ATGCCAGAGC
ATGTTATGTT AAAGTGGAAG ATGATGGTAT GCCTTTATAG CTTTGTACCT TATGTTTTAA ATTTCTTACT GCTGGTATTT
GCTTTTAGAA TAGTGTTTCC TGTTGCAACT ATTGCAGGCT GTGGTATTAC TCGTGACGAA CTGGTTCTTG TAGGAGAAAA
ATATGGTAAG TTAAAACTTC TACTATTATT TATACATTTT CGTTTACTCC CTATACTCAA AACTGCTGTT TTTGTCATAT
TAAACAATGA GGGTGCATTG TTGCAAGCTC CTTCACTTGT TGAAGCAGGC CTTATGGATG CTTATCTGAT TTCTCTAATG
TCAGAATAGA ATTATTATCT TACAGAAAAG AAAAGGTGAA TACATGATTT GCTTAGAATT AGATAGTAAT AATGGAAACA
GTATCATTCT GTGATATTTG ACATCGATTA TTGATATTGA AAGCAGATGT GTTTATTACT ATTTTTTATC ATCAGATGTT
TTTATTGTTA TTCGTATAGA TTGATGGTTG GTAAATGAAA TCACTGTGTT GTTTTTGCTG CTGATGTCAC CCAGTGATGC
TTTATGCAAA TCATCATTAG GTGCATAAGG ATTTCAAGAC AATATATCTT TGATTTCTCA CTTATGGGTC ATGAGAAGTT
AGTTGCATTA ATACCTGTTG GCAGGTGTGA ATTTACTATT TTGTTTATTA TGCTTATTCA CCGTTTCTTT GCAACCAAAT
ATATTTTGAT GTGCTGTCCT CAGGGTAAAA AAGAATTAGT TGTCAGTGGG TAGGATTATA GAAACCCCTT TATTTAAACT
TTTGTATCTT GTTAGATTCA TTCTTTTTTA AGACGTGTTA AATGTATATC CACCACCTTA ATTACAGTAA CCATTCACTC
TTGTTTTCAA TGCGCTAATA ATGTATAACT CTTTTATTCC ATAACAGCAA CATCCAAGTT TCATAATGTC ATGGTTGATG
GGGAACCTAG TTCCAGAAGT TTTGGATTAA ATGGCGAAGC ACTCGCATCA CTATCTGATA TCTCTGTTGT TGAAGTCAGG
ACAAAAGCTC GCGGGCGACC AAATTCATAT TGCAAGATAA TAAAGGTAGT TTACACACTT AACCTTTTAA AAGCTCAGCA
TAATCTTGAT ACATACATCC ATAGCGTATC TGAATTCTTC TGGCAAATAT ACAGGGATCC AAATGCTCAC ACCTGGGAAT
AGATGAGCAG AGGGAAGTTG TTGGAACCAC AGGTACATTT TTACTCTACA TTTAAAGATC AAGAAAATAA AATTTTACTC
TAGTCGTGTA TTCATGTGTG GTATATTTAC ATTTTTTGCC ATGTTATATA AGCTACGTAT CGTAATGTTT TTCATTTTTG
TGTAGTTATT GTTCGCGAGC TTTTTTACAA TCAACCTGTA CGCAGGAAAC AAATGCAATC TAGGTAAATC ATGTTATCTT
TTTCATCTGT ACATGTTTCT TACAATTCAC AATTTTGTTG GAAAGAAGAT TTGATTGTCT TTCTCAACAT TATGTTTTTG
TAGTTACAAA AGAGAACTAC ATCTTGTGAA GAAGTCTGTT CTGCGAGTTG CACTCATTCA TCCACAAGTT TCACTCAGAC
TTTTTGATAT TGAGAGGTAG TCTATTGTGC TACACTAGCC ATTTTTATTT TACCAATACC GCGTGAGAAA GTGTATCTAT
TGACATATCT TTTTTATGTA TGTAGTGAAG ATGAGTTGCT ATACACGATT CCTTCATCCT CCCCCTTGCC TCTTGTATCA
AACATTTTGG GGAAAAATGT CTCCAGCTGT CTTCATGAGA TAGCTACCTC TGACAAGCAT TTTGCTCTTT CAGGGCACAT
CTCCAGACCA ACAGATGTGT TCTGTAATAA GGTAACATTT ATCATATAAG TTGTGGGTTG TTGAACAAAA GTTTGGCAAC
ATGTATTCAG CAAAGTGTGT TTTTCCTCTG TAGGATTTCC AGTACTTGTG TATCCTACAA TCCAGTTCTT CACTGTCTAT
TTCCATAGTT TCACATACCA TTTTTCTGAA AGCTTGAGTT GGGAGATATC CTTGACTTTC CAAAGATATC AACTCAAGAT
TCGTCAGTAA AAGCCCAATC CACAATATGC TCAATAACCT GGCATCTAGT TTTCAATCTT CTGCAAGGAA TGAGGAAATT
GATGTTCGGA GTAAGAAGAG GCAGAAGAAT GAAGTCTACC CTGCATATCT GCTAAACTTG TGCTGTCCTA GATCAAGCTA
TGATCTACAT TTTGAGCCTT CACAGACTAT TGTGGAATTC AAGGTGATCC ATTACACATT TATGCTTTTT AATTCCCCTT
CTTTTTCTGG TAAAGCTTCA TATGTAAACA ACTGACCGGA TAAAAGTGGT TTGGGCTTTT TTTTTTTTTT GGGGGGGGGG
GCATGTTGAT TTGTACCTTC ATTTCTATTT ATTTTAAAAG CAAATTTTCT TTCTTATAGC TTGACATTCA TTTCCCATTC
TTTTTTATGG TTTTTCTACT CTTTAGGATT GGCAAACTGT CATGTATTTC TTTGAACGAA CTATCACAGA CTATTGGAAG
AAGCATGCAC CTCAACTGCC AGAAGGTTAG AAAAATATTT ACTTCCGTAA TGATGTCTTC CCTGAACAAT TTTGAAGTCT
AGAAGCTGTT GATTGAATGA TTTTCTTATT GTTATCCTTT TCTATTGTAG TGAAAGCTAT TGGCAATGAT ACCTGTGTGC
CTTTGGAAAG AGATGGTCAG TGATTTAGTG TACACGATTC TCTTCCTCTT TTGATTCGTC TGCCTTGTGA GCTTTGTGCA
CGTGTTGTTT TTGCAGTGAA ATCAAGTCAG GAACTGTTAA GGCGTCATGG TGTGCAGAAG AAAGAAGATG TCGCTGAATT
GTACCAAACA GCTCTGCAGA AGAATACAGT ACGAGACATG AATTTTGATA CAGCTGCCCC AGCAGAACCT AAAGACAATT
ACCTTTCTTT GGATATGGAG CCATCCACAT GGCGTGCCTG CTATGACCAG ATCAGTGATG CATCCCACAC AGATGATGTT
GCTAGGAATG GTCGGAAATT TGGTCATAAG CAAATATGTT CCCTTCAAAG TTATAGTTAT CAGTGGTTAG AGGACGGCTC
TTCCCTGTTA GAAGACTCTG ATCTTTCAAG TGCTAACCCA ACTATTTGTA AAATGCAAAA GACAGAAGAT ATATTCCATG
GGCATGCATA TTCTGGTAAG TTTGGACTGC TACAAGATGC AGAAATCGAA ATCGGTCCAG AAATTAAACT CCAAGAATAT
TGCTTTGAAT CTCCCAATAA ACCGAACAGA ATGACCTGCG ATTTTGTGCA AAAGCAAACC AATATAGAGG CACACATTTC
AGGCCGTGAT GGATTCTATG TTGATTTTGA TAAATTGAAC GAGGACTGTC TACTCAATGA GATATCAAAG ACAATCACTG
ATGTTTCCTG CCCTCAAATG CCACACTTTA ATGATGGACT CTGTCCTGAG GACGTTGGCT CCTCCAAGAG TTCCTGTAGT
GTCAGGAAAA AGTCTAGTAA AAGGCAAAAT AGTGCTAATG CAATTGCCCA GATGAAGTTC CATGATATGC AAGCAGTTTG
CGAAAGTGAT TACATGGATA GGTCCTTCAT CAAGGATACA TGTGGCCTTC ATTTCTTTCA TCCATTCTCG TTGGCTGATA
CACCTCGCAG TCACAGTCGT GCAAGGATTG ACTTGGAATT GCATGGAAGG TCAAATGAAA GCATTAACAG TTGGAACTGT
GAAAATATTG GCACTGATTT TGGATTTACT TCAGACAGGT TTAATATTGA TTCATCAATG ATTTTTGAAG GAAGCAAACA
TCTCAATAAC TTTGGCAATG GAACTCAATC TCCTAGTTAC TTCAATCATG AATATTGTTC TGTCGGTCAG TTTGCTTCCA
AACAGGATCG GATACCCTTG AAATCAAAAC ATGATGCAAG AATGTCATAT GATATTTCTC CTGAGAAAAG TTCTACTGGT
TGTCATTTGA ATGTTTCTTT TTCCCAAGTG GCAAAAAGCA GCAAGCTTAC TGAAGATCAG TATGGATGCA GTCAGAGGCC
CAGGCTTTCC AGAGGTAGAT ATAGGAGTCG TTCTGCACCA CCATTTTACA GAGGCAAAAG AAAATTCCCT AGATTAAACG
AACCACTAAC CAAATTGACT ACAGAAGGTG GTAAATATAC CACTGTTAAT GACTCAGGAG GTACGTCTTC TCAGAGCCAT
GGCAAATCTT TATACTGCTC TGTCATGAGC AATAAGTTTG TATCTTTTAT ACTGGATGCA GATATCACAC CTGTTCAGGA
GTATACATCA CATATGAACG CAACCCAACC TATTCCTGAG ACCTTTAGCA ATGACTTTTC TGACCTAAAT TTCAGGTATG
CTTCTTTTGC ATGTTGCCAT ACTACTGAGA ATGTCTTACT CTTTTTTTAT TTTTTCATAA ACCTCTTACT ATGTACTTAT
TTTTGCCATT TTCTTAGCTT GAAGGGAAAT GTCAAAATGT GCGAAGAGAA ATGTTCTGAT GAACTCGAAG ATTCTACTGC
TTCAGATGAA ATAACAAAAT GGCGTGATGA CTCTGACCAT CATGCAGTTG AGCATTTTGT GCCAAGAGTT ATATCACTGT
GCACAATTTT CTATGCTCAT ATTTTATCTC TCTGTGTAGG TTTCGGAGTT GCAACATGGT CCTTTTGAAC ACGATGATGA
TGTACTTAGC ATTTCTTATG GGCCCTTACA CCTCTCATGC AGTGTTCTAG TTCCTGAATG TATTGATAAA AATTGCTTTG
AGGAGGCAAG AGTTTTGTTG CAGCTGGATA AGAAATTTAT TCCTGTCATA TCTGGGGAAG TACTACTCCT TGTTGATCAG
GTCTGTAGTC AAGTATGTCA TTTGTGGAAA AAAGTTAAAT TTAGGAGTAT tctctccatt caaaagtctt aagacatatt
tcattttttg gtttttccaa aagtctaagg cctatttgta atctctatgt gctaaattaa attgttgacc ggaacacaag
aagccatctt agtacttatt ggttgcatgc atgtgtatac ttcattggtt ttgtcacatg gtggatgagt taattactcc
ttgatctttg tgacaaaaga aataggtctt agactttttg gatggaggga gtaTTATTTA GCAGTTTGTT TATATTGTTT
TGTGGTAATA GTCATGTTGT GGAGATGAAT TCTGTTGGAT TGCTTGTTGC ATTTGATGAC CGCGATACAA TACACTACTT
TTTTTTCTTA CTGTTTAGAA TTGACTAGTC ATAGGAGATG TTTGACCTTT ATGTATATGA TGCTTGAGCG CATAAAATGT
TTGAAATATA TGCAGGATAC CAGAAACTTG TTGGATTTTT TCTTTCTTTA AGCAGGAAGA ATTCATTTTT TATGTTCACA
TACTATATGA AGTAGTCAGT GTGTATATGG TGACAAAGGT ACTTCTCGGA CAGATTTTAG TAACTTACTC CTTGTTCTTA
CTATTTTACA GCATGCAGCT GATGAAAGGA TACGTTTGGA GGAACTCCGT CGAAAGGTTG TTTAACTTAA ATTGACCAGG
AATGTTCATA ACATTGTTTC CCCTCTTTCA TATTCACTTT GTTTGGATTT ACAGGTTTTA TCAGATGATG GCAGAGGGAT
TACTTACTTG GACTCTGAGG AGGACTTAGT ACGTCACTTT ATACTTTATA GCAGTTGGCA TCTGCTGCAC TGTGTTAATA
GCTTAATATA ATATATCTAA GAGAATTATT TTGAGATTAA GATAAGTTTT CTTTGAACAC TAGGATGTGT TGTTTGATCT
TCTATCATCT ATTTATTTGC CAGGTTCTCC CTGAGACTGG ATTTCAATTG TTCCAAAAGT ATATGCAACA GATCCAAAGT
TGGGGCTGGA TCATCAACAG TACTAATTCC TGTGAATCAT TCAAAAAGTA GGTGCCTGAC AATCATGTGA ATGAAAAACT
TTCTTTTGTG TACTTAGCCT TCGGTGCTAT TTTATCGAGG TCTTCTTGCA CATCTTCTAG TTATGTTCAT TTGAATCTAC
TTCTGTAATT AAGACAATCT GAGCCTTCTA GTGCTGTTTA GGTTGCACAA TTTTAGTTTG TGTTTATCAT ACCTTCAGCT
TCTTATAGTA TAAGAATAGT CAGTTCAGAA GGTCACATGA ATTTCTTCAA TTAACATTTG GTGATAACAT GTTATGATGC
TTTTGGATGG CTCAGTCCAT CATTCTCTAC CCATTGTGAA GGAGCAAAAA GCTGTTTATC CCCTCTGTAT ACACTAGAAT
ATAATAATTG ACACATACCA TTTACTTTAT ATTTTAAAGG AACATGAACG TTCTGAGGAG ACAATCGCGC CGTCTTACTC
TTGCTGCTGT GAGTAACCTT TTCTGCGACC CACATATATT CAACCTCTCT GCAATAGCTA CTTATCGTAC CACCCCTGCA
ATCTGTCTAG GTGGTGTGTT GCTTTGTACC TGTGTTGGTT ATATGCTTAT TTCTATGGTA AAAGTTAGTT TGATAACTTT
GATATCCATG AAATGTCCGA AAGTGTTTCA AAAGAATATA GACAAGCTTC AAACACTATA TTTCTTTGAA ACCTTCAGGC
CATGCTACGT TTCTTAAAAA TAAGGGAAAA AAATATTTAA TAAGGGATAC TTGTTCTCAT TGAGTCTGGT AATTAGCTGT
TTTTTATGCA ATTTGCTATC TGTAGCCATT TATGTTGTAG TGATCTAGTT AATCATTGTG TACATTTTTT TTTGTTACTG
CTATTTGAAG CGCAAATATT ATCAGGAGTG GCTGTGGATA TGCAATTGTC TTTTTTATAT CTTGTTTTTC TATGCATATT
ATCCTAATGC TGTTACAAAT ATCTGGCGAA ATTTTCTCAG AAAATTTGCA ACACATGTTA TAGTGCCCTC ATCATGTACC
CTGCACAGGT TCCATGTATT TTGGGCGTCA CTTTAACAGG AAAAGATCTT ATGGACTTCA TTCAGCAGGT GATTTATTCT
GCTACACTTC ATTTTAAGTT ATGAAACTCA TCAATTTAGG TCAACATTAG TCAAATTGTT TGGATGTGTA ATGCTTTTTC
TTGACAGTGT ATTTGTACAC CGTTAGATGT AGGTCCCGTG TCTTAGAAAA TGCTAGTTCG GAAGGAAGAT AAAACTGCAG
GGAAATGATT TGTTATTCTA ACTGCAGAGT TTTCTTATGC ATTGCTATTT TTTCCAGCTT GATGACACAG ATGGGTCGTC
AGCTATCCCC CCAGCGGTCA TTCGTATTCT CAATTTCAAG GCTTGCAGAG GTACACCTTG TATCTCTCCC CTTTTGTTCA
AAAGTTTTCA CCTCGACTCA AAAGCGACGC CCTGATGTTT GTTCTTGGTT GACCTTAGGT GCGATCATGT TTGGCGATCC
TCTGCTACCA TCGGAGTGCT CTCTGATTAT CGAAGAACTG AAAGCAACAT CTTTATGTTT CCAGGTACCA TCGAAATGCT
ACAATTTCCA GATCTTATTC TTACTGTTAT CTAAGCCATT GGTTTACTGA TGAAAGCTCC ATTAATAAAC CATTAGTAGT
GTCTAATCAA GGTTTTTCTT TGTTTTTTTT TCCTGGCAGT GTGCTCATGG ACGTCCGACC ACCGTGCCGA TTGTGAACGT
CGCATCTCTC CGCGGCGAGT TGGCGAGGCT CGGAGCGGTG AACGGAAGGC AAGAAGAGAC CTGGCATGGT CTCTCGCACC
ATGGACCCAG CCTTGAACGT GCTCGAACGC GCCTCAGAGA ACTGAGAAAG CTACGTGGTG GCCTGTAGCT GTACAACAGT
ACAAGATGTA GGATCATATA GAGGGTAAAT AGTCCAAAAG AAAAGGAGAA GTGTTGCATA GTGCTTCAAT AGGAAGCGGC
TTTGTAGTTT GCAGAGATAG ATATGCCATT GGTTCACGAA GAAGAGGTAA AATGGCCATG AGCCGTGTTG TACACTTGTA
AACCATTGTG ATTTGTGAAG GCCATTCTCA CCCTGTAAAT ATATGACAAT ATTTTTCGCA GTTTTCAGAG CAAAAGCCAA
GTCCGGCTCT CTTTTTTT

Locus: Os09g0551900

Loading...

Locus: Os09g0551900

Loading...