Os09t0554300-01

Locus

Os09g0554300

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS7a, PILS7a, OsPINL2

Oryzabase Gene Name Synonym(s)

PIN likes 7a

Transcript Evidence

AK070682 (DDBJ, Best hit)

Protein Evidence

NP_001147841.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

J023062B02 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0554300-01)

RiceXPro (AK070682)

Others

Oryzabase (19850)

KEGG (Os09t0554300-01)

Transcript

1912 bp

>Os09t0554300-01 Auxin efflux carrier domain containing protein.
ATTACCCAACCTCAAGCTAGCTAGCTCTCCACCGTCTGCGCCCATTCAGAAAAGGAGAGT
TTAATCCAACATCAGAAAAGATGGGCTTCTTGTCATTGCTTCTTGTGGCTTCTATGCCAA
TCGTTCAGGTCCTACTCATAGGTGTTATTGGAGCTTTTCTCGCTTCTGGTTACAGCAAAA
TTCTAACCTCAAGCGCTCTAAGGGATATGAACAAGGTTGTTTTCACTGTCTTCACACCAT
CCCTGATGTTTGCTAGCCTGGCTAAGACGGTCACACTTTCTGACGTCATTTCTTGGTGGT
TTATGCCAGTTAATATAGGAATCACATTCATTGTTGGTGGCACTCTAGGCTGGATAGCAT
GTAAAATACTGAAACCACCACAGCATTTCCGAGGAATGATCATTGCCTTCTGTTCAGCAG
GAAATCTTGGCAACTTGCTCTTGATCATTGTTCCAGCAGTCTGTGACGAAGACGGCAACC
CGTTCGGAAAAGACCGGAGCCTTTGCCGCTCTCGTGGGCTCTCCTACTCATCATTATCCA
TGGCTCTTGGTGGCTTATTCATATGGACACATACATACAGCCTCATGCAGAAGGCAGGCA
AAATGTACCACAAGATGCAGTCCAAAAGCATCCAGTGCCCGGCCGACAGCGATGAAGAGC
ATCATCCTGCACAAGGTCATGATCAAGTAAAATTAGACGGTGAAACTGCTTACGCTGATG
AGGAGGCGGCTCTTCTGGTGTCAGCTAAACTGGCTCCTGAACACAATGAAGAGAACCAAA
TGGAAGCTCCACTTCTGACTTGCGAGAGAGAGATTGCTAACAAAGGAGGATTCTGGACAA
ACCTGAAGGAAACCGTCCACCAGGTTGTCGAGGAGCTGATGGCACCACCAACTGTATCTG
CAATACTTGGATTTGTTGTTGGCCTAGTCCCATGGTTGAAATCTCTTGTCATCGGCAATG
GCGCCCCACTGAGAGTCATCCAGGAGTCCCTCCAACTAATGGGCAATGGCACGATTCCTT
GCATCACCCTAATCCTAGGGGGGAATCTGACACAAGGGCTACGGAAGTCGGTGCTGAAGC
GTACGGTGATCATCACGATCGTCTGCATACGCTACGTGATCCAACCCTTGATCGGGATGG
CGGTTGTCCATGCTGCCTATGGGGTTGGATTCTTGCCACACGATCCATTGTACCGCTACG
TGCTGATGATGCAGTTCGCGCTGCCACCTGCAATGAACATCGGAACCATGGCTCAGCTGT
TTGATGTTGGTCAAGAGGAATGCTCAGTGATCTTCTTGTGGACTTACCTGATTGCTGCCA
TTGCACTCACGACGTGGTCGACGATATTCATGTCCATCCTGTCTTGAGGTTGAGGGTGAC
AAGAAGAACCAACTTTGTGGCAATATTGGTTTAGCTGGAATGATTCAGCTCACGGATAAA
ATGTAAAGAAGCCGGAGACAATGAGCCTCTCCGAAAGAGCCGAAACTGAGGCTTGCCCAT
GAGCACCACACGTCCACACGTGTATAGAAATTGAAGCAGTATTTTTTTAGATAATGAAAA
ATAGCATGGTGGCCCGCGTAGATAACTATAATTTTTTTAACATATTAAAAAAtattttta
tttttttcagttatttcaaaattgtattttttatatggactctatactctactcccaatc
atcctcactttattaaatttctaattttgtagttcgaaattttgttatttctaaattata
ctcttcttatatggacttaatagtctatcgtcttctctaaatattctttttttatttgaa
attttacttatttctaaactgtactcctatatggacttagactggtgtaacgcacatcag
tcgtggcgttggtaggaaatacttaacaattcaataaaaaccctaattttcg

CDS

1287 bp

>Os09t0554300-01 Auxin efflux carrier domain containing protein.
ATGGGCTTCTTGTCATTGCTTCTTGTGGCTTCTATGCCAATCGTTCAGGTCCTACTCATA
GGTGTTATTGGAGCTTTTCTCGCTTCTGGTTACAGCAAAATTCTAACCTCAAGCGCTCTA
AGGGATATGAACAAGGTTGTTTTCACTGTCTTCACACCATCCCTGATGTTTGCTAGCCTG
GCTAAGACGGTCACACTTTCTGACGTCATTTCTTGGTGGTTTATGCCAGTTAATATAGGA
ATCACATTCATTGTTGGTGGCACTCTAGGCTGGATAGCATGTAAAATACTGAAACCACCA
CAGCATTTCCGAGGAATGATCATTGCCTTCTGTTCAGCAGGAAATCTTGGCAACTTGCTC
TTGATCATTGTTCCAGCAGTCTGTGACGAAGACGGCAACCCGTTCGGAAAAGACCGGAGC
CTTTGCCGCTCTCGTGGGCTCTCCTACTCATCATTATCCATGGCTCTTGGTGGCTTATTC
ATATGGACACATACATACAGCCTCATGCAGAAGGCAGGCAAAATGTACCACAAGATGCAG
TCCAAAAGCATCCAGTGCCCGGCCGACAGCGATGAAGAGCATCATCCTGCACAAGGTCAT
GATCAAGTAAAATTAGACGGTGAAACTGCTTACGCTGATGAGGAGGCGGCTCTTCTGGTG
TCAGCTAAACTGGCTCCTGAACACAATGAAGAGAACCAAATGGAAGCTCCACTTCTGACT
TGCGAGAGAGAGATTGCTAACAAAGGAGGATTCTGGACAAACCTGAAGGAAACCGTCCAC
CAGGTTGTCGAGGAGCTGATGGCACCACCAACTGTATCTGCAATACTTGGATTTGTTGTT
GGCCTAGTCCCATGGTTGAAATCTCTTGTCATCGGCAATGGCGCCCCACTGAGAGTCATC
CAGGAGTCCCTCCAACTAATGGGCAATGGCACGATTCCTTGCATCACCCTAATCCTAGGG
GGGAATCTGACACAAGGGCTACGGAAGTCGGTGCTGAAGCGTACGGTGATCATCACGATC
GTCTGCATACGCTACGTGATCCAACCCTTGATCGGGATGGCGGTTGTCCATGCTGCCTAT
GGGGTTGGATTCTTGCCACACGATCCATTGTACCGCTACGTGCTGATGATGCAGTTCGCG
CTGCCACCTGCAATGAACATCGGAACCATGGCTCAGCTGTTTGATGTTGGTCAAGAGGAA
TGCTCAGTGATCTTCTTGTGGACTTACCTGATTGCTGCCATTGCACTCACGACGTGGTCG
ACGATATTCATGTCCATCCTGTCTTGA

Protein

429 aa

>Os09t0554300-01 Auxin efflux carrier domain containing protein.
MGFLSLLLVASMPIVQVLLIGVIGAFLASGYSKILTSSALRDMNKVVFTVFTPSLMFASL
AKTVTLSDVISWWFMPVNIGITFIVGGTLGWIACKILKPPQHFRGMIIAFCSAGNLGNLL
LIIVPAVCDEDGNPFGKDRSLCRSRGLSYSSLSMALGGLFIWTHTYSLMQKAGKMYHKMQ
SKSIQCPADSDEEHHPAQGHDQVKLDGETAYADEEAALLVSAKLAPEHNEENQMEAPLLT
CEREIANKGGFWTNLKETVHQVVEELMAPPTVSAILGFVVGLVPWLKSLVIGNGAPLRVI
QESLQLMGNGTIPCITLILGGNLTQGLRKSVLKRTVIITIVCIRYVIQPLIGMAVVHAAY
GVGFLPHDPLYRYVLMMQFALPPAMNIGTMAQLFDVGQEECSVIFLWTYLIAAIALTTWS
TIFMSILS*

5'UTR

chr09:21963654..21963702 (+ strand) : 49 bp

chr09:21965049..21965079 (+ strand) : 31 bp

CDS

chr09:21965080..21965212 (+ strand) : 133 bp

chr09:21965295..21965376 (+ strand) : 82 bp

chr09:21965641..21965765 (+ strand) : 125 bp

chr09:21966099..21966223 (+ strand) : 125 bp

chr09:21966325..21966561 (+ strand) : 237 bp

chr09:21966654..21966773 (+ strand) : 120 bp

chr09:21966895..21966995 (+ strand) : 101 bp

chr09:21967099..21967151 (+ strand) : 53 bp

chr09:21967244..21967429 (+ strand) : 186 bp

chr09:21967550..21967674 (+ strand) : 125 bp

3'UTR

chr09:21967675..21968219 (+ strand) : 545 bp

FASTA

>Os09t0554300-01 class=Sequence position=chr09:21963654..21968219 (+ strand)
ATTACCCAAC CTCAAGCTAG CTAGCTCTCC ACCGTCTGCG CCCATTCAGG TCAGCTTCTG CTTTCTGACT GACTTTGAGT
TCTTCCCATG TTTTGTCCTC TGTCTCGCGT TCTCCTTGAT TTTGGGAGCT GGTAGAAAGC TAAGCTAGAT TTTAGCTTAG
CTCCGATTGC CATGGAGATC GTCTGGAGCA TGATTCGTCT GCCCTCCTGC TTCTTTGGAG GAAGCTAGCT AGTTATGTTT
TCTTGTGCAT TTTTTTCTCT TCTTCTTTCT TCTTCCTCGC TTTGCCTCGT TGATTTGGTG TTGCCTAGTC TTGCAATTAG
TTCTCAAACT TTGCTTCCTG TCGAGCAACT TGAGGCAATG AGCTGGCTGT TTTGAGCTGC ATGATGTTTC CAGCTACGAG
TACTGAAGAT GCAGTTTCTG GTAACTGCTG TCAGATTAGG ACTGCAATTA ACGGCTGGCT TTGCATTAGC ATTCTTTCCT
TTTTCTTTTT TTTTTCTTTT TGAAACCAAG CCATTCTTTC CTTTTTCTTG TTTACATGAA TGCGTGCGTT CTTTTTTCTT
TTTTGAACTT GTCATTGTTC TTGTAAATCT GCTAAAGTGC TAATTTGACA GCTAGGTTCC TGCTAAAATG GTTTCTATAT
ACATGAACGA AGTATAAAGA AACTTCCAGC TCTATACGGT TCTATCGCTG GCCTGAGAAT AAAAAATTGT AGTTCAATGC
CTCATCAGTG GACAACAATA TTCTCTGATA TTTAAGTTTC CATTTTCTTT CTTTTTTGGG ACCTTGCAAT CATTCCGTAA
AAGGAGGTGT TGTGCCCAGC AACATTGACT TGTTCAGTGT GCTCGAGCTT CACGTCTTTC ACCCTCTTGT AGGAGACGAT
GACCAAGAAC AGTGCAAGCA ATGTGGATAT GTCATTTTCA AATTAACTAA CACATGCTAG AAGATGGAAG AAAAAAATAT
AAATAAAAAT GGAATATTAA TAACTGTATT AGTAGTACTC AATTGCGTTC CTGAAGTTCT CATACGGTTC CCATACTCCT
TTTCTTTTTC TTTTTTTAAA TAAAAAAAAT AACTAATGTA TGTGACTAAG AAATCTAAAC GTTTCATTTC TTTATTGATC
GATTATCTTA GCAGGGTGTA CGAGCCCTGA AGAACTTTGA ATCATctttt ttttattatt tttttagaga agggtatttt
ttacccggcc tctatatcta accggatata tacggccatt gaaataggga atttaacccc gcaaacaacc caatctgaaa
ttcgcaccat aagagatttg aattcaggac cttaggatac tactcatgtc ACTGTAACCT CTAACTTTGA ATCATCTCCT
GAGGACTAAT CACAAGACAT CTGAAACATT TCCAGAAAAG GAGAGTTTAA TCCAACATCA GAAAAGATGG GCTTCTTGTC
ATTGCTTCTT GTGGCTTCTA TGCCAATCGT TCAGGTCCTA CTCATAGGTG TTATTGGAGC TTTTCTCGCT TCTGGTTACA
GCAAAATTCT AACCTCAAGC GCTCTAAGGG ATATGAACAA GGCGAGCTCT CATTAGCACA TCACTGTTCA ATGCAAATTA
ATCTGGTATT GTCTCTGGCT AAACCTGTTG AGATTTCTAA CAGGTTGTTT TCACTGTCTT CACACCATCC CTGATGTTTG
CTAGCCTGGC TAAGACGGTC ACACTTTCTG ACGTCATTTC TTGGTGAGTT TATACTTTAT ATATATATGC GGTTACTACA
AAGCAGCTCA GTCAGACTTT TCTGAATTTT TTGAAGTGTG GACTCTTCTG AATTTTAAAA GAATTCCTGT TTGAAATGAC
ATAGTACTAG ACTACTAGTA CCTTTAGAAC ACTAAACAAT GTTACACAAG TCATCTTTTC ATTCAGAGGC AGGGCATATA
AGATCTAGCT TCAGTTTCTG TTTGCAGGGT AACCCAACTG GACTAACAGA AGCCTTTTAT CATGCAGGTG GTTTATGCCA
GTTAATATAG GAATCACATT CATTGTTGGT GGCACTCTAG GCTGGATAGC ATGTAAAATA CTGAAACCAC CACAGCATTT
CCGAGGAATG ATCATTGCCT TCTGTTCAGC AGGTTCAGTT TCCTATCCGG ATTGCATCTT TCTTTTGTTC ATACTCCGGA
GATACATAAt actccctccg tttcgaaata tttgacaccg ttgacttttt agcacatgtt tgaccgttcg tcttatgcaa
aaacttttgt gaaatatgta aaattatatg cctacatgaa aatatattta tcaatgaatc aaatggtagg aaaagaatta
ataattactt aattttttta ataagacgaa cggtcaaata tgtgctaaaa agtcaacggc gtcgaatatt tcgaaacgga
gggagtaGTA TTTACAGTGC TTCAACTAAC AAAAATAAAA CGCAGGAAAT CTTGGCAACT TGCTCTTGAT CATTGTTCCA
GCAGTCTGTG ACGAAGACGG CAACCCGTTC GGAAAAGACC GGAGCCTTTG CCGCTCTCGT GGGCTCTCCT ACTCATCATT
ATCCATGGCT GTAAGCAAAA TTATATTTCT GCATCTCACA TTCACTGAAT TATCGTGTGC CTTTTTCATT CAGTTGAATA
ACAGAATTGA TCGTTCACTC TGTATCTGCA GCTTGGTGGC TTATTCATAT GGACACATAC ATACAGCCTC ATGCAGAAGG
CAGGCAAAAT GTACCACAAG ATGCAGTCCA AAAGCATCCA GTGCCCGGCC GACAGCGATG AAGAGCATCA TCCTGCACAA
GGTCATGATC AAGTAAAATT AGACGGTGAA ACTGCTTACG CTGATGAGGA GGCGGCTCTT CTGGTGTCAG CTAAACTGGC
TCCTGAACAC AATGAAGAGA ACCAAATGGT AAGTCGACTA ATTAATGGTC AGTCCAGTGC ACCATTGTCT GGTTCGTTCC
ATGCAAATCT TCAGAGAAAA CTGATTTGTC AGAAATGCAG GAAGCTCCAC TTCTGACTTG CGAGAGAGAG ATTGCTAACA
AAGGAGGATT CTGGACAAAC CTGAAGGAAA CCGTCCACCA GGTTGTCGAG GAGCTGATGG CACCACCAAC TGTATCTGCA
GTATGTTCCT GCCAAAACCA GTTACACCAT TTTCATCACA TCAAGTTGAT ATCAATGCTC ATTGCTCATA TTGGCAGTGT
CAACTGATTG CACTGAAGTT GTCTTTGTGT TGTTGTTTCA GATACTTGGA TTTGTTGTTG GCCTAGTCCC ATGGTTGAAA
TCTCTTGTCA TCGGCAATGG CGCCCCACTG AGAGTCATCC AGGAGTCCCT CCAACTAATG GGGTGAGTGA GCATTTACAT
GTTAGGTTTC TCCATTTCTG TCTGCCTTAA ACAGCATATT TCAAGTGTTT CCTCAGCCTT TACTCACGGT TCGTTTGTCT
TTCAGCAATG GCACGATTCC TTGCATCACC CTAATCCTAG GGGGGAATCT GACACAAGGT AGGTGTTAAT TACTCATGAA
CTAATGATAT GGAAATTAAC TGCATCATCT TGTGAGTTTT CTGAACTTCT CTGAATGTAT GTGCATGCAG GGCTACGGAA
GTCGGTGCTG AAGCGTACGG TGATCATCAC GATCGTCTGC ATACGCTACG TGATCCAACC CTTGATCGGG ATGGCGGTTG
TCCATGCTGC CTATGGGGTT GGATTCTTGC CACACGATCC ATTGTACCGC TACGTGCTGA TGATGCAGTT CGCGCTGCCA
CCTGCAATGA ACATCGGTAG CCCCTGAATC CCATGCAGTT TCATTCTGAT TTCTGAAGTT TCTTCTGTCC ATGCTTCTAG
GAAGATCTTG ATCACCTGAT CATGTGTCTT GTGTGTGTGT GATCTGTTCG ATCCAGGAAC CATGGCTCAG CTGTTTGATG
TTGGTCAAGA GGAATGCTCA GTGATCTTCT TGTGGACTTA CCTGATTGCT GCCATTGCAC TCACGACGTG GTCGACGATA
TTCATGTCCA TCCTGTCTTG AGGTTGAGGG TGACAAGAAG AACCAACTTT GTGGCAATAT TGGTTTAGCT GGAATGATTC
AGCTCACGGA TAAAATGTAA AGAAGCCGGA GACAATGAGC CTCTCCGAAA GAGCCGAAAC TGAGGCTTGC CCATGAGCAC
CACACGTCCA CACGTGTATA GAAATTGAAG CAGTATTTTT TTAGATAATG AAAAATAGCA TGGTGGCCCG CGTAGATAAC
TATAATTTTT TTAACATATT AAAAAAtatt tttatttttt tcagttattt caaaattgta ttttttatat ggactctata
ctctactccc aatcatcctc actttattaa atttctaatt ttgtagttcg aaattttgtt atttctaaat tatactcttc
ttatatggac ttaatagtct atcgtcttct ctaaatattc tttttttatt tgaaatttta cttatttcta aactgtactc
ctatatggac ttagactggt gtaacgcaca tcagtcgtgg cgttggtagg aaatacttaa caattcaata aaaaccctaa
ttttcg

Locus: Os09g0554300

Loading...

Locus: Os09g0554300

Loading...