Os09t0555100-00

Locus

Os09g0555100

Description

Similar to auxin Efflux Carrier family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS7b, PILS7b

Oryzabase Gene Name Synonym(s)

PIN likes 7b

Transcript Evidence

FP101824 (DDBJ)

Protein Evidence

NP_001147841.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Expression Databases

TENOR (Os09t0555100-00)

Others

Oryzabase (19851)

Transcript

1583 bp

>Os09t0555100-00 Similar to auxin Efflux Carrier family protein.
CAGAAAGCAAATCAAGGGATTATCAAGTAGGGCTCCAGAAGAAATTGAGTTTAATCCAGC
ATTAAAAAAGAGATGGGTTTCTTGGCATTGCTTCTGGTGGCTTCAATGCCAGTCGTCCAG
GTGCTACTCATAGGTGTTGTTGGAGCTTTTCTCGCTTCTGGTTACAGCAACATTCTAACT
TCAAGTGCTCTAAGCGATATGAACAAGGTTGTTTTCACCGTCTTCACACCATCTCTCATG
TTTGCTAGCCTGGCGAGGACGGTCACGTTTTCTGACGTCATTTCTTGGTGGTTTATGCCA
ATTAACATAGGGATCACATTCATGGCTGGTGGCACTCTAGGCTGGATAGCATGTAGAATC
TTGAAACCACCACAACATTTCAGAGGAATGATCATTGCCTTCTGCTCAGCAGGAAATCTT
GGCAACTTGCTCCTGATTGTTGTCCCAGCAGTCTGTGACGAAGATGGCAACCCGTTCGGA
AAAGACAGCAGCCGCTGCCGATCTCTTGGGCTCTCCTATTCATCATTGTCCATGGCTCTT
GGTGGCTTGTACATATGGACGCATACGTACAGTCTTATGAAGAAGAAGAGAGATCAAATG
TATCACCAGCCTAACAGCACTCAGTGCCTTGACGACAGCGATGAAGAACATCATTCTAAG
AAATTCAAAGCAAATGGTGAAGCTGCTTACGCCGATGAGGAGGCAACTCTTCCGGTGTCA
GCTAAACTGGCTCAACACAACGAAGAGAACCAAATGGAAGCTCCATTGCTGTCTTGCGAG
AGCAAGGTTGCTAAGAAATGCTCGTGGACAACAACAAACCTGAAGGACACCATCCACCAC
GTTGTCGAGGAGCTGATGGCACCACCAACTCTATCTGCTATACTTGGATTTGTTTTTGGG
CTAGTTCCATGGTTGAAATCTCTTGTCATCGGTGATGGCGCCCCTCTCAGAGTCATCCAG
GACTCCATCCAACTGATGGGAAATGGCACGATTCCTTGCGTCACCCTCATCCTTGGTGGA
AATCTGATAAAAGGGCTAAGGAAGTCGGAGCTCAAGCGTACGGTGATCATCGCGATCGTC
TGCATCCGCTACGTGATCCTTCCTCTAGTGGGGATTGCAGTAGTTCATGGTGCATACTGG
GTCGGATTCTTGCCACACGACCCGCTGTACCGCTACGTGCTGATGATGCAGTTCGCGCTG
CCACCTGCAATGACTATTGGAACCATGGCTCAACTGTTTGATGTTGCCCAAGAAGAATGC
TCAGTGTTATTTCTGTGGACTTACCTTGTTGCTTCCATTTCTCTCACCACCTGGTCCACG
ATATTCATGTCCATCCTGTCTTGAGGTCAAAGTCGACAAGAACAAAATGCGTCGTGATCT
TGGTTAAGTGCAATGATTTAAGCATTTCAGCTAACTCAAAGGGAGTAGGTTGAAGATAAT
AATACGCCTCTGGAAAAGAGTCGATCCAACTGAGGCTTGTTCGTGTCACCGTTTGCACCA
CCTGTATAAAAGGAGTTGAGCAGTATAGGCACAACGGTTTTTTTCTATCCCAATCTATTG
GTTCATTTAATTGGAATGGTTTT

CDS

1272 bp

>Os09t0555100-00 Similar to auxin Efflux Carrier family protein.
ATGGGTTTCTTGGCATTGCTTCTGGTGGCTTCAATGCCAGTCGTCCAGGTGCTACTCATA
GGTGTTGTTGGAGCTTTTCTCGCTTCTGGTTACAGCAACATTCTAACTTCAAGTGCTCTA
AGCGATATGAACAAGGTTGTTTTCACCGTCTTCACACCATCTCTCATGTTTGCTAGCCTG
GCGAGGACGGTCACGTTTTCTGACGTCATTTCTTGGTGGTTTATGCCAATTAACATAGGG
ATCACATTCATGGCTGGTGGCACTCTAGGCTGGATAGCATGTAGAATCTTGAAACCACCA
CAACATTTCAGAGGAATGATCATTGCCTTCTGCTCAGCAGGAAATCTTGGCAACTTGCTC
CTGATTGTTGTCCCAGCAGTCTGTGACGAAGATGGCAACCCGTTCGGAAAAGACAGCAGC
CGCTGCCGATCTCTTGGGCTCTCCTATTCATCATTGTCCATGGCTCTTGGTGGCTTGTAC
ATATGGACGCATACGTACAGTCTTATGAAGAAGAAGAGAGATCAAATGTATCACCAGCCT
AACAGCACTCAGTGCCTTGACGACAGCGATGAAGAACATCATTCTAAGAAATTCAAAGCA
AATGGTGAAGCTGCTTACGCCGATGAGGAGGCAACTCTTCCGGTGTCAGCTAAACTGGCT
CAACACAACGAAGAGAACCAAATGGAAGCTCCATTGCTGTCTTGCGAGAGCAAGGTTGCT
AAGAAATGCTCGTGGACAACAACAAACCTGAAGGACACCATCCACCACGTTGTCGAGGAG
CTGATGGCACCACCAACTCTATCTGCTATACTTGGATTTGTTTTTGGGCTAGTTCCATGG
TTGAAATCTCTTGTCATCGGTGATGGCGCCCCTCTCAGAGTCATCCAGGACTCCATCCAA
CTGATGGGAAATGGCACGATTCCTTGCGTCACCCTCATCCTTGGTGGAAATCTGATAAAA
GGGCTAAGGAAGTCGGAGCTCAAGCGTACGGTGATCATCGCGATCGTCTGCATCCGCTAC
GTGATCCTTCCTCTAGTGGGGATTGCAGTAGTTCATGGTGCATACTGGGTCGGATTCTTG
CCACACGACCCGCTGTACCGCTACGTGCTGATGATGCAGTTCGCGCTGCCACCTGCAATG
ACTATTGGAACCATGGCTCAACTGTTTGATGTTGCCCAAGAAGAATGCTCAGTGTTATTT
CTGTGGACTTACCTTGTTGCTTCCATTTCTCTCACCACCTGGTCCACGATATTCATGTCC
ATCCTGTCTTGA

Protein

424 aa

>Os09t0555100-00 Similar to auxin Efflux Carrier family protein.
MGFLALLLVASMPVVQVLLIGVVGAFLASGYSNILTSSALSDMNKVVFTVFTPSLMFASL
ARTVTFSDVISWWFMPINIGITFMAGGTLGWIACRILKPPQHFRGMIIAFCSAGNLGNLL
LIVVPAVCDEDGNPFGKDSSRCRSLGLSYSSLSMALGGLYIWTHTYSLMKKKRDQMYHQP
NSTQCLDDSDEEHHSKKFKANGEAAYADEEATLPVSAKLAQHNEENQMEAPLLSCESKVA
KKCSWTTTNLKDTIHHVVEELMAPPTLSAILGFVFGLVPWLKSLVIGDGAPLRVIQDSIQ
LMGNGTIPCVTLILGGNLIKGLRKSELKRTVIIAIVCIRYVILPLVGIAVVHGAYWVGFL
PHDPLYRYVLMMQFALPPAMTIGTMAQLFDVAQEECSVLFLWTYLVASISLTTWSTIFMS
ILS*

5'UTR

chr09:22007439..22007510 (+ strand) : 72 bp

CDS

chr09:22007511..22007645 (+ strand) : 135 bp

chr09:22007720..22007799 (+ strand) : 80 bp

chr09:22008135..22008259 (+ strand) : 125 bp

chr09:22008353..22008477 (+ strand) : 125 bp

chr09:22008555..22008773 (+ strand) : 219 bp

chr09:22008851..22008973 (+ strand) : 123 bp

chr09:22009054..22009154 (+ strand) : 101 bp

chr09:22009240..22009292 (+ strand) : 53 bp

chr09:22009365..22009550 (+ strand) : 186 bp

chr09:22009986..22010110 (+ strand) : 125 bp

3'UTR

chr09:22010111..22010349 (+ strand) : 239 bp

FASTA

>Os09t0555100-00 class=Sequence position=chr09:22007439..22010349 (+ strand)
CAGAAAGCAA ATCAAGGGAT TATCAAGTAG GGCTCCAGAA GAAATTGAGT TTAATCCAGC ATTAAAAAAG AGATGGGTTT
CTTGGCATTG CTTCTGGTGG CTTCAATGCC AGTCGTCCAG GTGCTACTCA TAGGTGTTGT TGGAGCTTTT CTCGCTTCTG
GTTACAGCAA CATTCTAACT TCAAGTGCTC TAAGCGATAT GAACAAGGTG AGCACATAGC CATTCACTGC GAAAAAATTG
TATTAATTGT CTCTGGCTGA TCTTGTTGAG ATTTCTGACA GGTTGTTTTC ACCGTCTTCA CACCATCTCT CATGTTTGCT
AGCCTGGCGA GGACGGTCAC GTTTTCTGAC GTCATTTCTT GGTGAGTTTC AGTTTATAGA TATGCAACAA TGCAAGTGCA
GTTACTACAA AATCTGCCCA AATTCCATCT CCACATTCTA ATAACTGCCA AAATCAACAC AATATGTATA GCTCAGCCAG
ACTTTCTGAA TTTTTTGAAC CGTAAGCTCT TTCTGAAATT TATAAGGATT CTTGCAGAAG TGAGAAACTC TCTTTCTGAA
ATAGAAAACA AGCTTTACAT ATATAGTTTT CTCATTCAGA GCACTGTTTA AATATCTGGG CAGAGCATAT ATACAATATC
CAAATTTTGT TTGCTGGGTA ACTCCACAGC ACTAACAAAA GAATTCTATC ATGTAGGTGG TTTATGCCAA TTAACATAGG
GATCACATTC ATGGCTGGTG GCACTCTAGG CTGGATAGCA TGTAGAATCT TGAAACCACC ACAACATTTC AGAGGAATGA
TCATTGCCTT CTGCTCAGCA GGTTAGTTTC CTAGGTGGAT TGCATGTTTT TACCCTCATA TTTTTGCTGA ATAATCCTAA
TGTTAGCAGT GTCATCAACT GACAAAAAAT GCAGGAAATC TTGGCAACTT GCTCCTGATT GTTGTCCCAG CAGTCTGTGA
CGAAGATGGC AACCCGTTCG GAAAAGACAG CAGCCGCTGC CGATCTCTTG GGCTCTCCTA TTCATCATTG TCCATGGCTG
TAAGGAACAA AAATATATCA TTCACTGAAT GATCAGCTGA ACAAAAGAAC TGACACACAC TGTATCTGCA CTGCAGCTTG
GTGGCTTGTA CATATGGACG CATACGTACA GTCTTATGAA GAAGAAGAGA GATCAAATGT ATCACCAGCC TAACAGCACT
CAGTGCCTTG ACGACAGCGA TGAAGAACAT CATTCTAAGA AATTCAAAGC AAATGGTGAA GCTGCTTACG CCGATGAGGA
GGCAACTCTT CCGGTGTCAG CTAAACTGGC TCAACACAAC GAAGAGAACC AAATGGTAAG TTGAGTGGTT TGTTCCTCGG
AAAAATTAAT CTTCAGAGAA AACTTAGTAC TATTAACTTG TCTGAAATTC AGGAAGCTCC ATTGCTGTCT TGCGAGAGCA
AGGTTGCTAA GAAATGCTCG TGGACAACAA CAAACCTGAA GGACACCATC CACCACGTTG TCGAGGAGCT GATGGCACCA
CCAACTCTAT CTGCTGTGTG TTCCTGACAA AACCAGCCAC AATATTTCAT CTCATCAACC CAGTCTTGGA CTAAATTTGG
TTATTCTTGC TTCAGATACT TGGATTTGTT TTTGGGCTAG TTCCATGGTT GAAATCTCTT GTCATCGGTG ATGGCGCCCC
TCTCAGAGTC ATCCAGGACT CCATCCAACT GATGGGGTAA GTTAGTATTT ACAGTGTTCT TCTTCATAGA GTATATTTCT
GTCTATTTTT CAGTGTTGCC CTTCTTTTGC TTGTCTTGCA GAAATGGCAC GATTCCTTGC GTCACCCTCA TCCTTGGTGG
AAATCTGATA AAAGGTAGGA TGTCAATTAC TCATGATTCA TGAAGCTGTG TGTTTTCTGA ACCTTTATCT GAATGTGTTT
ATGCAGGGCT AAGGAAGTCG GAGCTCAAGC GTACGGTGAT CATCGCGATC GTCTGCATCC GCTACGTGAT CCTTCCTCTA
GTGGGGATTG CAGTAGTTCA TGGTGCATAC TGGGTCGGAT TCTTGCCACA CGACCCGCTG TACCGCTACG TGCTGATGAT
GCAGTTCGCG CTGCCACCTG CAATGACTAT TGGTAATCTT TCCCTATAAC AGATGTCATT TTCTTCGTAC TCTCTGTATT
TAAATATATG GTACTGATGA TTTTATTTCG TCGATGCTTA TGATTTTATT TGGTCTTTAA TGTACAATGt tgacctctat
tttctatttt ctgttacaat ataacatttt ttatagctaa caaaattata atattgtaaa agtacttagc atgaagaaaa
aaacatacat atatgatttt ttatgtctta cactaaatat tttgagagct attgttatca aagttttaaa agtgtaaTAA
CCAAATAAAA TCAACAGTAT CATATATTTA AATACAACGA GCGTACTTAT TTTGCAAGGC AATACCATTT CGTTCTAAAG
CATTAGTCTC TGCTTCCAAT GAGATCTCCT CTGATCATGC CTCTTGCATG TGTGTGATCT AATACAGGAA CCATGGCTCA
ACTGTTTGAT GTTGCCCAAG AAGAATGCTC AGTGTTATTT CTGTGGACTT ACCTTGTTGC TTCCATTTCT CTCACCACCT
GGTCCACGAT ATTCATGTCC ATCCTGTCTT GAGGTCAAAG TCGACAAGAA CAAAATGCGT CGTGATCTTG GTTAAGTGCA
ATGATTTAAG CATTTCAGCT AACTCAAAGG GAGTAGGTTG AAGATAATAA TACGCCTCTG GAAAAGAGTC GATCCAACTG
AGGCTTGTTC GTGTCACCGT TTGCACCACC TGTATAAAAG GAGTTGAGCA GTATAGGCAC AACGGTTTTT TTCTATCCCA
ATCTATTGGT TCATTTAATT GGAATGGTTT T

Locus: Os09g0555100

Loading...

Locus: Os09g0555100

Loading...