Os09t0555700-01

Locus

Os09g0555700

Description

Zinc finger, C2H2-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IDD3

CGSNL Gene Name

INDETERMINATE DOMAIN 3

Oryzabase Gene Symbol Synonym(s)

OsIDD3

Oryzabase Gene Name Synonym(s)

indeterminate domain 3

Transcript Evidence

AK061264 (DDBJ, Best hit)

Protein Evidence

Q5UDB7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, C2H2 (IPR007087)

Zinc finger, C2H2-type/integrase, DNA-binding (IPR013087)

Zinc finger, C2H2-like (IPR015880)

Zinc finger, double-stranded RNA binding (IPR022755)

Full-length cDNA

006-212-C04 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0555700-01)

RiceXPro (AK061264)

Others

Oryzabase (13151)

KEGG (Os09t0555700-01)

Transcript

1050 bp

>Os09t0555700-01 Zinc finger, C2H2-type domain containing protein.
AAATCTTTGTTTTTCTTCTAACCTTGTTCCTCTCTCTTTCTCGCCCGAGCCATTTCTCCG
CGACCTCTTCTTCTCCCTCGCTTGGCACGGTGTGCTAGCTTCCATATCTCTTCCTCTTTT
GATTAGTTCCTTCTTCTGCCGTCTCGCGGTTGCTTCTGTGTTTGTTTGCATCAGAAGCGG
CCGGAGGAGAGGCAGATAGATAAACAGTGCCAGCCATGTCGCCTCCTCTGTGACTTAAAT
TGGACTGAATTGATCAGGTGGCTGCGCCTCACCTGAAGCCAACAAAGTAAGCAGCGAGAG
GACGCGCCGCCAGGGTAGGGAGAGCAAGCTATATATCTAGCTGTGCTGTGCTGTAGTGAT
CGATCTCTCCCTGTTGTTTTGCGGGGATGGCGGCCGCCTCGTCCGCACCCTTCTTTGGGC
TCGGCGACACGCAGATGCCGCCGCCGCAGAATCCCACCAATCCAGCCCTCCACCACCACC
CCAACCCCTCCCCCGCTCCCGTCGCCGCCGCCGCGCCCGCGCCGAAGAAGAAGAGGAACC
AGCCTGGAAACCCAAATCCAGATGCGGAGGTGATAGCGCTGTCGCCGCGGACGCTGATGG
CGACCAACAGGTTCGTGTGCGAGGTGTGCAACAAGGGGTTCCAGCGGGAGCAGAACCTGC
AGCTGCACCGGCGAGGGCACAACCTGCCGTGGAAGCTGAAGCAGAAGAACCCCAAGGAGG
CTCGCCGGCGCGTGTACCTGTGCCCGGAGCCGTCGTGCGTCCACCACGACCCGTCGCGGG
CCCTCGGCGACCTCACCGGGATCAAGAAGCACTACTGCCGCAAGCACGGCGAGAAGAAGT
GGCGCTGCGACAAGTGCTCCAAGCGCTACGCCGTGCAGTCCGACTGGAAGGCCCACTCCA
AGACCTGCGGCACCCGCGAGTACCGCTGCGACTGCGGCACCCTCTTCTCCAGGTCCGTAT
GCTTCGATCTTGATCTTCCTCGTCTCGTCCATGGATTGATTCGTTCACGATCTAAGTTAA
TTAATTCGAGTAATTGATCCATATCTTTGC

CDS

651 bp

>Os09t0555700-01 Zinc finger, C2H2-type domain containing protein.
ATGGCGGCCGCCTCGTCCGCACCCTTCTTTGGGCTCGGCGACACGCAGATGCCGCCGCCG
CAGAATCCCACCAATCCAGCCCTCCACCACCACCCCAACCCCTCCCCCGCTCCCGTCGCC
GCCGCCGCGCCCGCGCCGAAGAAGAAGAGGAACCAGCCTGGAAACCCAAATCCAGATGCG
GAGGTGATAGCGCTGTCGCCGCGGACGCTGATGGCGACCAACAGGTTCGTGTGCGAGGTG
TGCAACAAGGGGTTCCAGCGGGAGCAGAACCTGCAGCTGCACCGGCGAGGGCACAACCTG
CCGTGGAAGCTGAAGCAGAAGAACCCCAAGGAGGCTCGCCGGCGCGTGTACCTGTGCCCG
GAGCCGTCGTGCGTCCACCACGACCCGTCGCGGGCCCTCGGCGACCTCACCGGGATCAAG
AAGCACTACTGCCGCAAGCACGGCGAGAAGAAGTGGCGCTGCGACAAGTGCTCCAAGCGC
TACGCCGTGCAGTCCGACTGGAAGGCCCACTCCAAGACCTGCGGCACCCGCGAGTACCGC
TGCGACTGCGGCACCCTCTTCTCCAGGTCCGTATGCTTCGATCTTGATCTTCCTCGTCTC
GTCCATGGATTGATTCGTTCACGATCTAAGTTAATTAATTCGAGTAATTGA

Protein

217 aa

>Os09t0555700-01 Zinc finger, C2H2-type domain containing protein.
MAAASSAPFFGLGDTQMPPPQNPTNPALHHHPNPSPAPVAAAAPAPKKKRNQPGNPNPDA
EVIALSPRTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLKQKNPKEARRRVYLCP
EPSCVHHDPSRALGDLTGIKKHYCRKHGEKKWRCDKCSKRYAVQSDWKAHSKTCGTREYR
CDCGTLFSRSVCFDLDLPRLVHGLIRSRSKLINSSN*

5'UTR

chr09:22070324..22070492 (- strand) : 169 bp

chr09:22069918..22070134 (- strand) : 217 bp

CDS

chr09:22069749..22069917 (- strand) : 169 bp

chr09:22069173..22069654 (- strand) : 482 bp

3'UTR

chr09:22069160..22069172 (- strand) : 13 bp

FASTA

>Os09t0555700-01 class=Sequence position=chr09:22069160..22070492 (- strand)
AAATCTTTGT TTTTCTTCTA ACCTTGTTCC TCTCTCTTTC TCGCCCGAGC CATTTCTCCG CGACCTCTTC TTCTCCCTCG
CTTGGCACGG TGTGCTAGCT TCCATATCTC TTCCTCTTTT GATTAGTTCC TTCTTCTGCC GTCTCGCGGT TGCTTCTGTG
TTTGTTTGCG TGAGTGCAAC TTGTTCGTTT GTCATCTCTC TCTTGCGTTA ATTGTTGTTT TGCATGCAAA CATGAGTGTT
TTTTTTTTGT TTTGTGGTTT GTCCTGTGGC AGGAACCACA CATATTTGTT ATCTAGGTGA ATGCTAAATT TGGTTACAAG
TATTTATGTG TTGCTCACTT CTTTCACTTG TCTTTTAGAT CAGAAGCGGC CGGAGGAGAG GCAGATAGAT AAACAGTGCC
AGCCATGTCG CCTCCTCTGT GACTTAAATT GGACTGAATT GATCAGGTGG CTGCGCCTCA CCTGAAGCCA ACAAAGTAAG
CAGCGAGAGG ACGCGCCGCC AGGGTAGGGA GAGCAAGCTA TATATCTAGC TGTGCTGTGC TGTAGTGATC GATCTCTCCC
TGTTGTTTTG CGGGGATGGC GGCCGCCTCG TCCGCACCCT TCTTTGGGCT CGGCGACACG CAGATGCCGC CGCCGCAGAA
TCCCACCAAT CCAGCCCTCC ACCACCACCC CAACCCCTCC CCCGCTCCCG TCGCCGCCGC CGCGCCCGCG CCGAAGAAGA
AGAGGAACCA GCCTGGAAAC CCAAGCAAGT GTTCTTTCTT GATCGATTGA TTTCCCCTTT CTTCTTCGTT CGATTGTATC
GTGTTAAAAT TAATCAGTTG TCGATTCTTC TCGTGCAGAT CCAGATGCGG AGGTGATAGC GCTGTCGCCG CGGACGCTGA
TGGCGACCAA CAGGTTCGTG TGCGAGGTGT GCAACAAGGG GTTCCAGCGG GAGCAGAACC TGCAGCTGCA CCGGCGAGGG
CACAACCTGC CGTGGAAGCT GAAGCAGAAG AACCCCAAGG AGGCTCGCCG GCGCGTGTAC CTGTGCCCGG AGCCGTCGTG
CGTCCACCAC GACCCGTCGC GGGCCCTCGG CGACCTCACC GGGATCAAGA AGCACTACTG CCGCAAGCAC GGCGAGAAGA
AGTGGCGCTG CGACAAGTGC TCCAAGCGCT ACGCCGTGCA GTCCGACTGG AAGGCCCACT CCAAGACCTG CGGCACCCGC
GAGTACCGCT GCGACTGCGG CACCCTCTTC TCCAGGTCCG TATGCTTCGA TCTTGATCTT CCTCGTCTCG TCCATGGATT
GATTCGTTCA CGATCTAAGT TAATTAATTC GAGTAATTGA TCCATATCTT TGC

Locus: Os09g0555700

Loading...

Locus: Os09g0555700

Loading...