Os09t0555700-02

Locus

Os09g0555700

Description

Indeterminate domain (IDD) protein, Regulation of defense to sheath blight disease, Negative regulation of plant erectness

RAP-DB Gene Symbol Synonym(s)

IDD3

RAP-DB Gene Name Synonym(s)

indeterminate domain 3

CGSNL Gene Symbol

IDD3

CGSNL Gene Name

INDETERMINATE DOMAIN 3

Oryzabase Gene Symbol Synonym(s)

OsIDD3

Oryzabase Gene Name Synonym(s)

indeterminate domain 3

Transcript Evidence

AK101950

Protein Evidence

B7ERE7

Literature

PMID: 32842845

PMID: 32140886

Note

Manual Curation

August 27, 2020

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Zinc finger C2H2 superfamily (IPR036236)

Zinc finger C2H2-type (IPR013087)

Zinc finger, double-stranded RNA binding (IPR022755)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J033075E02 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0555700-02)

RiceXPro (AK101950)

Others

Oryzabase (13151)

Transcript

2261 bp

>Os09t0555700-02 Indeterminate domain (IDD) protein, Regulation of defense to sheath blight disease, Negative regulation of plant erectness
GCCCGAGCCATTTCTCCGCGACCTCTTCTTCTCCCTCGCTTGGCACGATCAGAAGCGGCC
GGAGGAGAGGCAGATAGATAAACAGTGCCAGCCATGTCGCCTCCTCTGTGACTTAAATTG
GACTGAATTGATCAGGTGGCTGCGCCTCACCTGAAGCCAACAAAGTAAGCAGCGAGAGGA
CGCGCCGCCAGGGTAGGGAGAGCAAGCTATATATCTAGCTGTGCTGTGCTGTAGTGATCG
ATCTCTCCCTGTTGTTTTGCGGGGATGGCGGCCGCCTCGTCCGCACCCTTCTTTGGGCTC
GGCGACACGCAGATGCCGCCGCCGCAGAATCCCACCAATCCAGCCCTCCACCACCACCCC
AACCCCTCCCCCGCTCCCGTCGCCGCCGCCGCGCCCGCGCCGAAGAAGAAGAGGAACCAG
CCTGGAAACCCAAATCCAGATGCGGAGGTGATAGCGCTGTCGCCGCGGACGCTGATGGCG
ACCAACAGGTTCGTGTGCGAGGTGTGCAACAAGGGGTTCCAGCGGGAGCAGAACCTGCAG
CTGCACCGGCGAGGGCACAACCTGCCGTGGAAGCTGAAGCAGAAGAACCCCAAGGAGGCT
CGCCGGCGCGTGTACCTGTGCCCGGAGCCGTCGTGCGTCCACCACGACCCGTCGCGGGCC
CTCGGCGACCTCACCGGGATCAAGAAGCACTACTGCCGCAAGCACGGCGAGAAGAAGTGG
CGCTGCGACAAGTGCTCCAAGCGCTACGCCGTGCAGTCCGACTGGAAGGCCCACTCCAAG
ACCTGCGGCACCCGCGAGTACCGCTGCGACTGCGGCACCCTCTTCTCCAGGAGGGACAGC
TTCATCACCCACCGCGCCTTCTGCGACGCGCTGGCGCAGGAGAACGCGCGCATGCCGCCC
ATCGGCGCCGGCGTATACGGCGGCGCCGGCAACATGACACTTGGGCTCACCGGCATGGCC
GCCCCGCAACTTCCCGCCGGCTTCCCTGATCAGGCCGGCCAGCCGTCGGCGTCGGCCGGC
GATGTCCTCCGCCTCGGCGGCGGCAGCAATGGCGCCTCTCAGTTTGATCACCTCATGGCC
TCGTCGTCGGGCTCCTCCATGTTCCGCTCGCAGGGATCGTCGTCCTCCTCGTTCTACCTC
GCCAATGGCGCCGCCCATCATGCTCCCGCTCAGGACTTCGGCCCGGAGGACGGCCAGTCT
CAGGCCGGCCAGGGCTCGCTGCTCCACGGCAAGCCGGCGGCGTTCCATGACCTGATGCAG
CTCCCCGTGCAGCACCAGCAAAGCGGCAATGGTAACCTCCTCAACCTTGGCTTCTTCTCC
GGCAGCAATGGCGGCGTCGACCAGTTCAACGGCGGCGCTGGAAACGGCGGGCAGGGCAGC
ATCGTTACTTCTAGCGGCCTCGCCGGCAACCACGGCGGCGGCGGCGGCGGCTTCCCTTCT
CTGTACAACTCGTCCGAACCGGCCGGTACACTGCCGCAGATGTCGGCGACGGCGCTCTTG
CAGAAGGCTGCCCAGATGGGTGCAACGACGAGCAGCTACAACGCCGGCGGCGCCGGTGGC
GCGAGCTCGCTGCTCCGTGGAGCTAGCTCCCACGGGATCAGCGTCGGTGAAGGGCCGGCC
AACGAGAGGTCGTCGTACCAGAATCTCATCATGGGCTCCATGGCGAGCGGCGGCGGTGGC
GCGGGTTTCGCCGGTAGCTTCTCCGGCGCGTCTGGATTCGGTGGCGCCGTCGACGACGGC
AAGCTGAGCACGAGGGACTTCCTCGGCGTCGGCGTCGTCCAGGGCATCAGCGGCTCGGCG
GCAATGGGGCCGCCGCGCCATGGCGCGGCCGGCCTCCACGTCGGCTCACTGGACCCGGCA
AACATGAACTGAAGTCATCACAGAGAAGAAAAAAAACAATAGAAGACGGAAGGAGATGAT
CATGCTGCTAATTTCATTTCATCATATCAGAATTAGTCAAGAAACTGGAGGTAATTAATT
AAGAAGAGAAAAGCGATTTCAATCCATGCAAGATGGATGTTTCTGGGGAAATCTGGAGCT
GTTAATGGTGAGTCGTAGTTGCTAGCTAGCTAGCCAGAGCTGGGAGGAATAATAATAATA
CCTGGATTAAGTGGCCAGAACTTAATTTTGTACCGGTACATTTCGTTTGTTTTTCATGTA
CTTTTGGCAGGGAAATGGGTCTCTTTTGATGTGAAGTCATCATGTGAAGGCCTGACCCCA
GACTAGAATCAATTCAAGCGCGCGCTGTGCCTGGATTAATT

CDS

1608 bp

>Os09t0555700-02 Indeterminate domain (IDD) protein, Regulation of defense to sheath blight disease, Negative regulation of plant erectness
ATGGCGGCCGCCTCGTCCGCACCCTTCTTTGGGCTCGGCGACACGCAGATGCCGCCGCCG
CAGAATCCCACCAATCCAGCCCTCCACCACCACCCCAACCCCTCCCCCGCTCCCGTCGCC
GCCGCCGCGCCCGCGCCGAAGAAGAAGAGGAACCAGCCTGGAAACCCAAATCCAGATGCG
GAGGTGATAGCGCTGTCGCCGCGGACGCTGATGGCGACCAACAGGTTCGTGTGCGAGGTG
TGCAACAAGGGGTTCCAGCGGGAGCAGAACCTGCAGCTGCACCGGCGAGGGCACAACCTG
CCGTGGAAGCTGAAGCAGAAGAACCCCAAGGAGGCTCGCCGGCGCGTGTACCTGTGCCCG
GAGCCGTCGTGCGTCCACCACGACCCGTCGCGGGCCCTCGGCGACCTCACCGGGATCAAG
AAGCACTACTGCCGCAAGCACGGCGAGAAGAAGTGGCGCTGCGACAAGTGCTCCAAGCGC
TACGCCGTGCAGTCCGACTGGAAGGCCCACTCCAAGACCTGCGGCACCCGCGAGTACCGC
TGCGACTGCGGCACCCTCTTCTCCAGGAGGGACAGCTTCATCACCCACCGCGCCTTCTGC
GACGCGCTGGCGCAGGAGAACGCGCGCATGCCGCCCATCGGCGCCGGCGTATACGGCGGC
GCCGGCAACATGACACTTGGGCTCACCGGCATGGCCGCCCCGCAACTTCCCGCCGGCTTC
CCTGATCAGGCCGGCCAGCCGTCGGCGTCGGCCGGCGATGTCCTCCGCCTCGGCGGCGGC
AGCAATGGCGCCTCTCAGTTTGATCACCTCATGGCCTCGTCGTCGGGCTCCTCCATGTTC
CGCTCGCAGGGATCGTCGTCCTCCTCGTTCTACCTCGCCAATGGCGCCGCCCATCATGCT
CCCGCTCAGGACTTCGGCCCGGAGGACGGCCAGTCTCAGGCCGGCCAGGGCTCGCTGCTC
CACGGCAAGCCGGCGGCGTTCCATGACCTGATGCAGCTCCCCGTGCAGCACCAGCAAAGC
GGCAATGGTAACCTCCTCAACCTTGGCTTCTTCTCCGGCAGCAATGGCGGCGTCGACCAG
TTCAACGGCGGCGCTGGAAACGGCGGGCAGGGCAGCATCGTTACTTCTAGCGGCCTCGCC
GGCAACCACGGCGGCGGCGGCGGCGGCTTCCCTTCTCTGTACAACTCGTCCGAACCGGCC
GGTACACTGCCGCAGATGTCGGCGACGGCGCTCTTGCAGAAGGCTGCCCAGATGGGTGCA
ACGACGAGCAGCTACAACGCCGGCGGCGCCGGTGGCGCGAGCTCGCTGCTCCGTGGAGCT
AGCTCCCACGGGATCAGCGTCGGTGAAGGGCCGGCCAACGAGAGGTCGTCGTACCAGAAT
CTCATCATGGGCTCCATGGCGAGCGGCGGCGGTGGCGCGGGTTTCGCCGGTAGCTTCTCC
GGCGCGTCTGGATTCGGTGGCGCCGTCGACGACGGCAAGCTGAGCACGAGGGACTTCCTC
GGCGTCGGCGTCGTCCAGGGCATCAGCGGCTCGGCGGCAATGGGGCCGCCGCGCCATGGC
GCGGCCGGCCTCCACGTCGGCTCACTGGACCCGGCAAACATGAACTGA

Protein

536 aa

>Os09t0555700-02 Indeterminate domain (IDD) protein, Regulation of defense to sheath blight disease, Negative regulation of plant erectness
MAAASSAPFFGLGDTQMPPPQNPTNPALHHHPNPSPAPVAAAAPAPKKKRNQPGNPNPDA
EVIALSPRTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLKQKNPKEARRRVYLCP
EPSCVHHDPSRALGDLTGIKKHYCRKHGEKKWRCDKCSKRYAVQSDWKAHSKTCGTREYR
CDCGTLFSRRDSFITHRAFCDALAQENARMPPIGAGVYGGAGNMTLGLTGMAAPQLPAGF
PDQAGQPSASAGDVLRLGGGSNGASQFDHLMASSSGSSMFRSQGSSSSSFYLANGAAHHA
PAQDFGPEDGQSQAGQGSLLHGKPAAFHDLMQLPVQHQQSGNGNLLNLGFFSGSNGGVDQ
FNGGAGNGGQGSIVTSSGLAGNHGGGGGGFPSLYNSSEPAGTLPQMSATALLQKAAQMGA
TTSSYNAGGAGGASSLLRGASSHGISVGEGPANERSSYQNLIMGSMASGGGGAGFAGSFS
GASGFGGAVDDGKLSTRDFLGVGVVQGISGSAAMGPPRHGAAGLHVGSLDPANMN*

5'UTR

chr09:22070404..22070450 (- strand) : 47 bp

chr09:22069918..22070134 (- strand) : 217 bp

CDS

chr09:22069749..22069917 (- strand) : 169 bp

chr09:22069258..22069654 (- strand) : 397 bp

chr09:22064863..22065904 (- strand) : 1042 bp

3'UTR

chr09:22064474..22064862 (- strand) : 389 bp

FASTA

>Os09t0555700-02 class=Sequence position=chr09:22064474..22070450 (- strand)
GCCCGAGCCA TTTCTCCGCG ACCTCTTCTT CTCCCTCGCT TGGCACGGTG TGCTAGCTTC CATATCTCTT CCTCTTTTGA
TTAGTTCCTT CTTCTGCCGT CTCGCGGTTG CTTCTGTGTT TGTTTGCGTG AGTGCAACTT GTTCGTTTGT CATCTCTCTC
TTGCGTTAAT TGTTGTTTTG CATGCAAACA TGAGTGTTTT TTTTTTGTTT TGTGGTTTGT CCTGTGGCAG GAACCACACA
TATTTGTTAT CTAGGTGAAT GCTAAATTTG GTTACAAGTA TTTATGTGTT GCTCACTTCT TTCACTTGTC TTTTAGATCA
GAAGCGGCCG GAGGAGAGGC AGATAGATAA ACAGTGCCAG CCATGTCGCC TCCTCTGTGA CTTAAATTGG ACTGAATTGA
TCAGGTGGCT GCGCCTCACC TGAAGCCAAC AAAGTAAGCA GCGAGAGGAC GCGCCGCCAG GGTAGGGAGA GCAAGCTATA
TATCTAGCTG TGCTGTGCTG TAGTGATCGA TCTCTCCCTG TTGTTTTGCG GGGATGGCGG CCGCCTCGTC CGCACCCTTC
TTTGGGCTCG GCGACACGCA GATGCCGCCG CCGCAGAATC CCACCAATCC AGCCCTCCAC CACCACCCCA ACCCCTCCCC
CGCTCCCGTC GCCGCCGCCG CGCCCGCGCC GAAGAAGAAG AGGAACCAGC CTGGAAACCC AAGCAAGTGT TCTTTCTTGA
TCGATTGATT TCCCCTTTCT TCTTCGTTCG ATTGTATCGT GTTAAAATTA ATCAGTTGTC GATTCTTCTC GTGCAGATCC
AGATGCGGAG GTGATAGCGC TGTCGCCGCG GACGCTGATG GCGACCAACA GGTTCGTGTG CGAGGTGTGC AACAAGGGGT
TCCAGCGGGA GCAGAACCTG CAGCTGCACC GGCGAGGGCA CAACCTGCCG TGGAAGCTGA AGCAGAAGAA CCCCAAGGAG
GCTCGCCGGC GCGTGTACCT GTGCCCGGAG CCGTCGTGCG TCCACCACGA CCCGTCGCGG GCCCTCGGCG ACCTCACCGG
GATCAAGAAG CACTACTGCC GCAAGCACGG CGAGAAGAAG TGGCGCTGCG ACAAGTGCTC CAAGCGCTAC GCCGTGCAGT
CCGACTGGAA GGCCCACTCC AAGACCTGCG GCACCCGCGA GTACCGCTGC GACTGCGGCA CCCTCTTCTC CAGGTCCGTA
TGCTTCGATC TTGATCTTCC TCGTCTCGTC CATGGATTGA TTCGTTCACG ATCTAAGTTA ATTAATTCGA GTAATTGATC
CATATCTTTG CAATTAATTC TTTCGCGAAT TGAATTGACA GCAAAATCGG CTGGCTAGGA TAGTAGCTAG ATAGATATAT
TCCTTTCGAA TTCAATGGGG TATTATTATC TTCCTGTTTT GTTCGTTCGC ATGATTGGGT CATGATGAAC TCGATCGCGG
GAAAGTGATC GATCGATTTG ATGGGTGGTG GTGGTAGTAC GCCTTTGTTA GGGTTAGCTA GGGTTGTCGT CGTTCGTTCG
TTGCTATAGC TCGTTGCTCC GCCATGGAAG AGATTGGATT CCTTCGAGAG AGAAGGAACG GTAGGGACGA CGACGATCTC
CATAGACGCG CCGCGCGCGC GTGCGCTGCG TGCAGTGGAT CGAGCATGAA ATGCGACGAG AGGGCATGAG CGCTGCTGCT
CCCACGTGAA CCGTTCTTGT CGGGAGGAGA CGGGAGAGAT ATGCATCCTG ACATGGGCGA CGGCTCAAAA AGGAGCCATC
TCCTCCTTTT TTCCACCTCG GAAACCACGC TCCTCTCCTC TCCTCTCTCT TCCCCCACCT GTTCACGTGG TGAGACATAC
GCGCCCCCGT CGTTCGTCTG CAAGCTGCTA CAAGCCACGG CATCCAATCC AAACATGCCT CGCAGCGCGG CGGCTGGCTA
GCTTGTTTCT CATGTGATCG TGTAGCTGCA TTCCGTGGTG GGCAACTGGC CGGCAAGCAG TGTACTGTAC TACTGCTGTT
GCTGTGCTTG CTTGACCCAT GCGTCCGGTA AAAATCTTAG CTTCTTCTCT CTCTCTCTCT CTCTCTCTCT CTCTACCTCC
ATCTATCTAT ATCTCTGGCA TACTGCACTG TCATTGGTTT TAATTACTAG CTAGCTGCAT GACAATTATT AGCCACAAGC
CTGCATGCAG CCGGATGCAT GGATTGGCCG CTAGCTGGTG TTTTCTTGTG ATTTATGCTT GCTACTCTCT GTTGATAGTA
GCAGCAGATA TGGTGCTAGT GCTACAGCTA AGATGATTTA TTTTCGTTAT TAATATTGGA GGTTTTTATG CGAGAATTTC
ATTTCTGTAG CTGTTGCATG CGTACGTTTA CTCATTCATT AATTATTTGG TTTTATTTGC CAGCCTGCAA CTAATCTGTA
CGCAATCAAT CTACAGCTAG TAGTGACCAA GTATTTTTGG CAGTGAAATA AATTGATGAT TAATTGAAAT ACTATCCTTG
CATGCCATTA ATTCTTCAGT TTTCTTCACC TCTGTATTGC TGGTGATATG CACTAGTCAT TAATAGTACA CTTAAGATTG
TTGCCAGAGC AGTGACAATA ATCTACTGCT ATGTATAGAT TCCATGTTTT AATTACTACC CACAACTGAG ACACCAGTAA
TTAATCAGCA CATTTAAAAT TCCCGCCATG TGTGATTTTC AATATATTGC AAATCAATGA TGAATATATA AGCTTAATTG
ATTGTAAAAA TGAACTGCCC ATTTTTCTTT TTGCGAGGAA AAAAATGACC TGCCCATTAT ATTACAATGG AATATTGATC
AACTGGCACT TAGGCTCAGT TTGAGGCTCA GTTTGAAATT AATCTCGTTA AGCTTTTTGC AACTTttttt aaaccactat
gtgtgtattc ttttaaaaaa agttaattat atacaagttt cttttaaaaa ataaaaaata cttattttta tgtttataat
agttaatacg gaattaatca tacgctaata tatttcttat tttacttgcc tgcacccaaa ctaagccaaA CCATTCGAAA
GAACGTAGCC TTAGTTATGC ATGTGTACAC GCTTATATCA TATGCTAGCC AGCTTTGGTT GCGGACCCGA TCACAGAATA
TGTTGAGAAA AAATTCACTA TAATTTTGTA GCAAAAAAAT ATAATTTCAC TCTAACTTGA CTAAAGAGGC TGATCAGGGA
ACTGCCGTGC GCGCCGCATC GTGCGTACCC ACCTGTGTTC GAATCCCATT CGACATGTGT GTTCACATTC TTTTCATTCT
TTATCAATGC ATACCATACC AAGTTACTCT TTGGTATCCA AAATTTAAAG GCTGCTTTTT TTAGCGAAAA ATATAGTTTC
ACTCTAAGTT GACTAAAGAG GCTGATCAGG GCGTTGTCGC GTCACGCGTG CGTTcccacc cgtgttcaaa tcccattcga
cacgcgtgtt cacatttttt tcattctcta tcaatgcata ccataccATG TTACTCCTTG GTATCCAAAA TTTAAAGGCT
GCTTTTTTTA GCGAAAAATA TAGTTTCCCT CTAAGTTGAC TAAAGAGGTT GATCAGGGCG TTGTCGCGTC ACGCATGCGT
GCCCACCCGT GTTCGAATCC CATTAGACGC GCGTGTTCAT ATTTTTTTTC ATTCTCTATC AATGTATACC ATACCAAGTT
ACTCCTTGGT GTTCAAAATT TAAGGGCTGC TTTTTTTAGC GAAAAATATA GTTTCCCTCT AAGTTGACTA AAGAGGctga
tcaggacgct gtcgcgtcac gcatgcgtgc ccacccatgt tcgaatcaca tttggcatgc gtattcacat ttttttcctt
ctctatcaat taatacatac cAAATTCCTC CACCATGGTA TCCAAAATTT TAAATTAAGG CTGCGCTTGC Atacccaccc
gtgttcgaat cccattcggc acgcgtgttc acattttttc ccttctctat caatAATTAG Ccaattaatc ccctaaccat
tccatttttc tccctttttt ttaaattttt tttggctcac tgtctgattt acacgtcgct gctctctcct cctggctcct
cgcgcgcgcc caaatgaccg ctcgtaagca gtaaccggtc aaacaaaatt ttgggcgccg tgggagactg catacgcgcc
ggtatccaat acgagttaga gccggttgta ttacaaggct attttgcaaa aaaTACATAC CAAGTTTCTC CACCATGGTA
TCCAAAAATT TAAAGGCTGA TTATCCTGGC TATAATTTAG TGTTCATGTT CACTCCAATA GTGAATGCTA TAGCTCCTAG
CTAGCTCCAA TAGTGATGCT CCAGAATTTC AAAAACGAAT TTCATTATTG CCCGCAGTGA TTGAAAAGTA GTTGTACTAC
TCACTGTAAA TATACTATAG CGCCATATGT GATCATGTAT AGTGGTACAA CGAATTTTTA CTGAGATTAT TTCACGCATG
CACAATGCAT TCCATGAAAT AATTTGATAC ATTTGTGTTC TTCACATATT GGATCAAAAT ATGCAGGAGG GACAGCTTCA
TCACCCACCG CGCCTTCTGC GACGCGCTGG CGCAGGAGAA CGCGCGCATG CCGCCCATCG GCGCCGGCGT ATACGGCGGC
GCCGGCAACA TGACACTTGG GCTCACCGGC ATGGCCGCCC CGCAACTTCC CGCCGGCTTC CCTGATCAGG CCGGCCAGCC
GTCGGCGTCG GCCGGCGATG TCCTCCGCCT CGGCGGCGGC AGCAATGGCG CCTCTCAGTT TGATCACCTC ATGGCCTCGT
CGTCGGGCTC CTCCATGTTC CGCTCGCAGG GATCGTCGTC CTCCTCGTTC TACCTCGCCA ATGGCGCCGC CCATCATGCT
CCCGCTCAGG ACTTCGGCCC GGAGGACGGC CAGTCTCAGG CCGGCCAGGG CTCGCTGCTC CACGGCAAGC CGGCGGCGTT
CCATGACCTG ATGCAGCTCC CCGTGCAGCA CCAGCAAAGC GGCAATGGTA ACCTCCTCAA CCTTGGCTTC TTCTCCGGCA
GCAATGGCGG CGTCGACCAG TTCAACGGCG GCGCTGGAAA CGGCGGGCAG GGCAGCATCG TTACTTCTAG CGGCCTCGCC
GGCAACCACG GCGGCGGCGG CGGCGGCTTC CCTTCTCTGT ACAACTCGTC CGAACCGGCC GGTACACTGC CGCAGATGTC
GGCGACGGCG CTCTTGCAGA AGGCTGCCCA GATGGGTGCA ACGACGAGCA GCTACAACGC CGGCGGCGCC GGTGGCGCGA
GCTCGCTGCT CCGTGGAGCT AGCTCCCACG GGATCAGCGT CGGTGAAGGG CCGGCCAACG AGAGGTCGTC GTACCAGAAT
CTCATCATGG GCTCCATGGC GAGCGGCGGC GGTGGCGCGG GTTTCGCCGG TAGCTTCTCC GGCGCGTCTG GATTCGGTGG
CGCCGTCGAC GACGGCAAGC TGAGCACGAG GGACTTCCTC GGCGTCGGCG TCGTCCAGGG CATCAGCGGC TCGGCGGCAA
TGGGGCCGCC GCGCCATGGC GCGGCCGGCC TCCACGTCGG CTCACTGGAC CCGGCAAACA TGAACTGAAG TCATCACAGA
GAAGAAAAAA AACAATAGAA GACGGAAGGA GATGATCATG CTGCTAATTT CATTTCATCA TATCAGAATT AGTCAAGAAA
CTGGAGGTAA TTAATTAAGA AGAGAAAAGC GATTTCAATC CATGCAAGAT GGATGTTTCT GGGGAAATCT GGAGCTGTTA
ATGGTGAGTC GTAGTTGCTA GCTAGCTAGC CAGAGCTGGG AGGAATAATA ATAATACCTG GATTAAGTGG CCAGAACTTA
ATTTTGTACC GGTACATTTC GTTTGTTTTT CATGTACTTT TGGCAGGGAA ATGGGTCTCT TTTGATGTGA AGTCATCATG
TGAAGGCCTG ACCCCAGACT AGAATCAATT CAAGCGCGCG CTGTGCCTGG ATTAATT

Locus: Os09g0555700

Loading...

Locus: Os09g0555700

Loading...