Os09t0555700-03

Locus

Os09g0555700

Description

Zinc finger, C2H2-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IDD3

CGSNL Gene Name

INDETERMINATE DOMAIN 3

Oryzabase Gene Symbol Synonym(s)

OsIDD3

Oryzabase Gene Name Synonym(s)

indeterminate domain 3

Transcript Evidence

AK101181 (DDBJ, Best hit)

Protein Evidence

Q5UDB7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, C2H2 (IPR007087)

Zinc finger, C2H2-type/integrase, DNA-binding (IPR013087)

Zinc finger, C2H2-like (IPR015880)

Zinc finger, double-stranded RNA binding (IPR022755)

Full-length cDNA

J033029F02 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0555700-03)

RiceXPro (AK101181)

Others

Oryzabase (13151)

KEGG (Os09t0555700-03)

Transcript

2041 bp

>Os09t0555700-03 Zinc finger, C2H2-type domain containing protein.
GATCTCTCCCTGTTGTTTTGCGGGGATGGCGGCCGCCTCGTCCGCACCCTTCTTTGGGCT
CGGCGACACGCAGATGCCGCCGCCGCAGAATCCCACCAATCCAGCCCTCCACCACCACCC
CAACCCCTCCCCCGCTCCCGTCGCCGCCGCCGCGCCCGCGCCGAAGAAGAAGAGGAACCA
GCCTGGAAACCCAAATCCAGATGCGGAGGTGATAGCGCTGTCGCCGCGGACGCTGATGGC
GACCAACAGGTTCGTGTGCGAGGTGTGCAACAAGGGGTTCCAGCGGGAGCAGAACCTGCA
GCTGCACCGGCGAGGGCACAACCTGCCGTGGAAGCTGAAGCAGAAGAACCCCAAGGAGGC
TCGCCGGCGCGTGTACCTGTGCCCGGAGCCGTCGTGCGTCCACCACGACCCGTCGCGGGC
CCTCGGCGACCTCACCGGGATCAAGAAGCACTACTGCCGCAAGCACGGCGAGAAGAAGTG
GCGCTGCGACAAGTGCTCCAAGCGCTACGCCGTGCAGTCCGACTGGAAGGCCCACTCCAA
GACCTGCGGCACCCGCGAGTACCGCTGCGACTGCGGCACCCTCTTCTCCAGGAGGGACAG
CTTCATCACCCACCGCGCCTTCTGCGACGCGCTGGCGCAGGAGAACGCGCGCATGCCGCC
CATCGGCGCCGGCGTATACGGCGGCGCCGGCAACATGACACTTGGGCTCACCGGCATGGC
CGCCCCGCAACTTCCCGCCGGCTTCCCTGATCAGGCCGGCCAGCCGTCGGCGTCGGCCGG
CGATGTCCTCCGCCTCGGCGGCGGCAGCAATGGCGCCTCTCAGTTTGATCACCTCATGGC
CTCGTCGTCGGGCTCCTCCATGTTCCGCTCGCAGGGATCGTCGTCCTCCTCGTTCTACCT
CGCCAATGGCGCCGCCCATCATGCTCCCGCTCAGGACTTCGGCCCGGAGGACGGCCAGTC
TCAGGCCGGCCAGGGCTCGCTGCTCCACGGCAAGCCGGCGGCGTTCCATGACCTGATGCA
GCTCCCCGTGCAGCACCAGCAAAGCGGCAATGGTAACCTCCTCAACCTTGGCTTCTTCTC
CGGCAGCAATGGCGGCGTCGACCAGTTCAACGGCGGCGCTGGAAACGGCGGGCAGGGCAG
CATCGTTACTTCTAGCGGCCTCGCCGGCAACCACGGCGGCGGCGGCGGCGGCTTCCCTTC
TCTGTACAACTCGTCCGAACCGGCCGGTACACTGCCGCAGATGTCGGCGACGGCGCTCTT
GCAGAAGGCTGCCCAGATGGGTGCAACGACGAGCAGCTACAACGCCGGCGGCGCCGGTGG
CGCGAGCTCGCTGCTCCGTGGAGCTAGCTCCCACGGGATCAGCGTCGGTGAAGGGCCGGC
CAACGAGAGGTCGTCGTACCAGAATCTCATCATGGGCTCCATGGCGAGCGGCGGCGGTGG
CGCGGGTTTCGCCGGTAGCTTCTCCGGCGCGTCTGGATTCGGTGGCGCCGTCGACGACGG
CAAGCTGAGCACGAGGGACTTCCTCGGCGTCGGCGTCGTCCAGGGCATCAGCGGCTCGGC
GGCAATGGGGCCGCCGCGCCATGGCGCGGCCGGCCTCCACGTCGGCTCACTGGACCCGGC
AAACATGAACTGAAGTCATCACAGAGAAGAAAAAAAACAATAGAAGACGGAAGGAGATGA
TCATGCTGCTAATTTCATTTCATCATATCAGAATTAGTCAAGAAACTGGAGGTAATTAAT
TAAGAAGAGAAAAGCGATTTCAATCCATGCAAGATGGATGTTTCTGGGGAAATCTGGAGC
TGTTAATGGTGAGTCGTAGTTGCTAGCTAGCTAGCCAGAGCTGGGAGGAATAATAATAAT
ACCTGGATTAAGTGGCCAGAACTTAATTTTGTACCGGTACATTTCGTTTGTTTTTCATGT
ACTTTTGGCAGGGAAATGGGTCTCTTTTGATGTGAAGTCATCATGTGAAGGCCTGACCCC
AGACTAGAATCAATTCAAGCGCGCGCTGTGCCTGGATTAATTAATCTTGGAGTTTTATTG
C

CDS

1608 bp

>Os09t0555700-03 Zinc finger, C2H2-type domain containing protein.
ATGGCGGCCGCCTCGTCCGCACCCTTCTTTGGGCTCGGCGACACGCAGATGCCGCCGCCG
CAGAATCCCACCAATCCAGCCCTCCACCACCACCCCAACCCCTCCCCCGCTCCCGTCGCC
GCCGCCGCGCCCGCGCCGAAGAAGAAGAGGAACCAGCCTGGAAACCCAAATCCAGATGCG
GAGGTGATAGCGCTGTCGCCGCGGACGCTGATGGCGACCAACAGGTTCGTGTGCGAGGTG
TGCAACAAGGGGTTCCAGCGGGAGCAGAACCTGCAGCTGCACCGGCGAGGGCACAACCTG
CCGTGGAAGCTGAAGCAGAAGAACCCCAAGGAGGCTCGCCGGCGCGTGTACCTGTGCCCG
GAGCCGTCGTGCGTCCACCACGACCCGTCGCGGGCCCTCGGCGACCTCACCGGGATCAAG
AAGCACTACTGCCGCAAGCACGGCGAGAAGAAGTGGCGCTGCGACAAGTGCTCCAAGCGC
TACGCCGTGCAGTCCGACTGGAAGGCCCACTCCAAGACCTGCGGCACCCGCGAGTACCGC
TGCGACTGCGGCACCCTCTTCTCCAGGAGGGACAGCTTCATCACCCACCGCGCCTTCTGC
GACGCGCTGGCGCAGGAGAACGCGCGCATGCCGCCCATCGGCGCCGGCGTATACGGCGGC
GCCGGCAACATGACACTTGGGCTCACCGGCATGGCCGCCCCGCAACTTCCCGCCGGCTTC
CCTGATCAGGCCGGCCAGCCGTCGGCGTCGGCCGGCGATGTCCTCCGCCTCGGCGGCGGC
AGCAATGGCGCCTCTCAGTTTGATCACCTCATGGCCTCGTCGTCGGGCTCCTCCATGTTC
CGCTCGCAGGGATCGTCGTCCTCCTCGTTCTACCTCGCCAATGGCGCCGCCCATCATGCT
CCCGCTCAGGACTTCGGCCCGGAGGACGGCCAGTCTCAGGCCGGCCAGGGCTCGCTGCTC
CACGGCAAGCCGGCGGCGTTCCATGACCTGATGCAGCTCCCCGTGCAGCACCAGCAAAGC
GGCAATGGTAACCTCCTCAACCTTGGCTTCTTCTCCGGCAGCAATGGCGGCGTCGACCAG
TTCAACGGCGGCGCTGGAAACGGCGGGCAGGGCAGCATCGTTACTTCTAGCGGCCTCGCC
GGCAACCACGGCGGCGGCGGCGGCGGCTTCCCTTCTCTGTACAACTCGTCCGAACCGGCC
GGTACACTGCCGCAGATGTCGGCGACGGCGCTCTTGCAGAAGGCTGCCCAGATGGGTGCA
ACGACGAGCAGCTACAACGCCGGCGGCGCCGGTGGCGCGAGCTCGCTGCTCCGTGGAGCT
AGCTCCCACGGGATCAGCGTCGGTGAAGGGCCGGCCAACGAGAGGTCGTCGTACCAGAAT
CTCATCATGGGCTCCATGGCGAGCGGCGGCGGTGGCGCGGGTTTCGCCGGTAGCTTCTCC
GGCGCGTCTGGATTCGGTGGCGCCGTCGACGACGGCAAGCTGAGCACGAGGGACTTCCTC
GGCGTCGGCGTCGTCCAGGGCATCAGCGGCTCGGCGGCAATGGGGCCGCCGCGCCATGGC
GCGGCCGGCCTCCACGTCGGCTCACTGGACCCGGCAAACATGAACTGA

Protein

536 aa

>Os09t0555700-03 Zinc finger, C2H2-type domain containing protein.
MAAASSAPFFGLGDTQMPPPQNPTNPALHHHPNPSPAPVAAAAPAPKKKRNQPGNPNPDA
EVIALSPRTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLKQKNPKEARRRVYLCP
EPSCVHHDPSRALGDLTGIKKHYCRKHGEKKWRCDKCSKRYAVQSDWKAHSKTCGTREYR
CDCGTLFSRRDSFITHRAFCDALAQENARMPPIGAGVYGGAGNMTLGLTGMAAPQLPAGF
PDQAGQPSASAGDVLRLGGGSNGASQFDHLMASSSGSSMFRSQGSSSSSFYLANGAAHHA
PAQDFGPEDGQSQAGQGSLLHGKPAAFHDLMQLPVQHQQSGNGNLLNLGFFSGSNGGVDQ
FNGGAGNGGQGSIVTSSGLAGNHGGGGGGFPSLYNSSEPAGTLPQMSATALLQKAAQMGA
TTSSYNAGGAGGASSLLRGASSHGISVGEGPANERSSYQNLIMGSMASGGGGAGFAGSFS
GASGFGGAVDDGKLSTRDFLGVGVVQGISGSAAMGPPRHGAAGLHVGSLDPANMN*

5'UTR

chr09:22069918..22069942 (- strand) : 25 bp

CDS

chr09:22069749..22069917 (- strand) : 169 bp

chr09:22069258..22069654 (- strand) : 397 bp

chr09:22064863..22065904 (- strand) : 1042 bp

3'UTR

chr09:22064455..22064862 (- strand) : 408 bp

FASTA

>Os09t0555700-03 class=Sequence position=chr09:22064455..22069942 (- strand)
GATCTCTCCC TGTTGTTTTG CGGGGATGGC GGCCGCCTCG TCCGCACCCT TCTTTGGGCT CGGCGACACG CAGATGCCGC
CGCCGCAGAA TCCCACCAAT CCAGCCCTCC ACCACCACCC CAACCCCTCC CCCGCTCCCG TCGCCGCCGC CGCGCCCGCG
CCGAAGAAGA AGAGGAACCA GCCTGGAAAC CCAAGCAAGT GTTCTTTCTT GATCGATTGA TTTCCCCTTT CTTCTTCGTT
CGATTGTATC GTGTTAAAAT TAATCAGTTG TCGATTCTTC TCGTGCAGAT CCAGATGCGG AGGTGATAGC GCTGTCGCCG
CGGACGCTGA TGGCGACCAA CAGGTTCGTG TGCGAGGTGT GCAACAAGGG GTTCCAGCGG GAGCAGAACC TGCAGCTGCA
CCGGCGAGGG CACAACCTGC CGTGGAAGCT GAAGCAGAAG AACCCCAAGG AGGCTCGCCG GCGCGTGTAC CTGTGCCCGG
AGCCGTCGTG CGTCCACCAC GACCCGTCGC GGGCCCTCGG CGACCTCACC GGGATCAAGA AGCACTACTG CCGCAAGCAC
GGCGAGAAGA AGTGGCGCTG CGACAAGTGC TCCAAGCGCT ACGCCGTGCA GTCCGACTGG AAGGCCCACT CCAAGACCTG
CGGCACCCGC GAGTACCGCT GCGACTGCGG CACCCTCTTC TCCAGGTCCG TATGCTTCGA TCTTGATCTT CCTCGTCTCG
TCCATGGATT GATTCGTTCA CGATCTAAGT TAATTAATTC GAGTAATTGA TCCATATCTT TGCAATTAAT TCTTTCGCGA
ATTGAATTGA CAGCAAAATC GGCTGGCTAG GATAGTAGCT AGATAGATAT ATTCCTTTCG AATTCAATGG GGTATTATTA
TCTTCCTGTT TTGTTCGTTC GCATGATTGG GTCATGATGA ACTCGATCGC GGGAAAGTGA TCGATCGATT TGATGGGTGG
TGGTGGTAGT ACGCCTTTGT TAGGGTTAGC TAGGGTTGTC GTCGTTCGTT CGTTGCTATA GCTCGTTGCT CCGCCATGGA
AGAGATTGGA TTCCTTCGAG AGAGAAGGAA CGGTAGGGAC GACGACGATC TCCATAGACG CGCCGCGCGC GCGTGCGCTG
CGTGCAGTGG ATCGAGCATG AAATGCGACG AGAGGGCATG AGCGCTGCTG CTCCCACGTG AACCGTTCTT GTCGGGAGGA
GACGGGAGAG ATATGCATCC TGACATGGGC GACGGCTCAA AAAGGAGCCA TCTCCTCCTT TTTTCCACCT CGGAAACCAC
GCTCCTCTCC TCTCCTCTCT CTTCCCCCAC CTGTTCACGT GGTGAGACAT ACGCGCCCCC GTCGTTCGTC TGCAAGCTGC
TACAAGCCAC GGCATCCAAT CCAAACATGC CTCGCAGCGC GGCGGCTGGC TAGCTTGTTT CTCATGTGAT CGTGTAGCTG
CATTCCGTGG TGGGCAACTG GCCGGCAAGC AGTGTACTGT ACTACTGCTG TTGCTGTGCT TGCTTGACCC ATGCGTCCGG
TAAAAATCTT AGCTTCTTCT CTCTCTCTCT CTCTCTCTCT CTCTCTACCT CCATCTATCT ATATCTCTGG CATACTGCAC
TGTCATTGGT TTTAATTACT AGCTAGCTGC ATGACAATTA TTAGCCACAA GCCTGCATGC AGCCGGATGC ATGGATTGGC
CGCTAGCTGG TGTTTTCTTG TGATTTATGC TTGCTACTCT CTGTTGATAG TAGCAGCAGA TATGGTGCTA GTGCTACAGC
TAAGATGATT TATTTTCGTT ATTAATATTG GAGGTTTTTA TGCGAGAATT TCATTTCTGT AGCTGTTGCA TGCGTACGTT
TACTCATTCA TTAATTATTT GGTTTTATTT GCCAGCCTGC AACTAATCTG TACGCAATCA ATCTACAGCT AGTAGTGACC
AAGTATTTTT GGCAGTGAAA TAAATTGATG ATTAATTGAA ATACTATCCT TGCATGCCAT TAATTCTTCA GTTTTCTTCA
CCTCTGTATT GCTGGTGATA TGCACTAGTC ATTAATAGTA CACTTAAGAT TGTTGCCAGA GCAGTGACAA TAATCTACTG
CTATGTATAG ATTCCATGTT TTAATTACTA CCCACAACTG AGACACCAGT AATTAATCAG CACATTTAAA ATTCCCGCCA
TGTGTGATTT TCAATATATT GCAAATCAAT GATGAATATA TAAGCTTAAT TGATTGTAAA AATGAACTGC CCATTTTTCT
TTTTGCGAGG AAAAAAATGA CCTGCCCATT ATATTACAAT GGAATATTGA TCAACTGGCA CTTAGGCTCA GTTTGAGGCT
CAGTTTGAAA TTAATCTCGT TAAGCTTTTT GCAACTTttt ttaaaccact atgtgtgtat tcttttaaaa aaagttaatt
atatacaagt ttcttttaaa aaataaaaaa tacttatttt tatgtttata atagttaata cggaattaat catacgctaa
tatatttctt attttacttg cctgcaccca aactaagcca aACCATTCGA AAGAACGTAG CCTTAGTTAT GCATGTGTAC
ACGCTTATAT CATATGCTAG CCAGCTTTGG TTGCGGACCC GATCACAGAA TATGTTGAGA AAAAATTCAC TATAATTTTG
TAGCAAAAAA ATATAATTTC ACTCTAACTT GACTAAAGAG GCTGATCAGG GAACTGCCGT GCGCGCCGCA TCGTGCGTAC
CCACCTGTGT TCGAATCCCA TTCGACATGT GTGTTCACAT TCTTTTCATT CTTTATCAAT GCATACCATA CCAAGTTACT
CTTTGGTATC CAAAATTTAA AGGCTGCTTT TTTTAGCGAA AAATATAGTT TCACTCTAAG TTGACTAAAG AGGCTGATCA
GGGCGTTGTC GCGTCACGCG TGCGTTccca cccgtgttca aatcccattc gacacgcgtg ttcacatttt tttcattctc
tatcaatgca taccataccA TGTTACTCCT TGGTATCCAA AATTTAAAGG CTGCTTTTTT TAGCGAAAAA TATAGTTTCC
CTCTAAGTTG ACTAAAGAGG TTGATCAGGG CGTTGTCGCG TCACGCATGC GTGCCCACCC GTGTTCGAAT CCCATTAGAC
GCGCGTGTTC ATATTTTTTT TCATTCTCTA TCAATGTATA CCATACCAAG TTACTCCTTG GTGTTCAAAA TTTAAGGGCT
GCTTTTTTTA GCGAAAAATA TAGTTTCCCT CTAAGTTGAC TAAAGAGGct gatcaggacg ctgtcgcgtc acgcatgcgt
gcccacccat gttcgaatca catttggcat gcgtattcac atttttttcc ttctctatca attaatacat accAAATTCC
TCCACCATGG TATCCAAAAT TTTAAATTAA GGCTGCGCTT GCAtacccac ccgtgttcga atcccattcg gcacgcgtgt
tcacattttt tcccttctct atcaatAATT AGCcaattaa tcccctaacc attccatttt tctccctttt ttttaaattt
tttttggctc actgtctgat ttacacgtcg ctgctctctc ctcctggctc ctcgcgcgcg cccaaatgac cgctcgtaag
cagtaaccgg tcaaacaaaa ttttgggcgc cgtgggagac tgcatacgcg ccggtatcca atacgagtta gagccggttg
tattacaagg ctattttgca aaaaaTACAT ACCAAGTTTC TCCACCATGG TATCCAAAAA TTTAAAGGCT GATTATCCTG
GCTATAATTT AGTGTTCATG TTCACTCCAA TAGTGAATGC TATAGCTCCT AGCTAGCTCC AATAGTGATG CTCCAGAATT
TCAAAAACGA ATTTCATTAT TGCCCGCAGT GATTGAAAAG TAGTTGTACT ACTCACTGTA AATATACTAT AGCGCCATAT
GTGATCATGT ATAGTGGTAC AACGAATTTT TACTGAGATT ATTTCACGCA TGCACAATGC ATTCCATGAA ATAATTTGAT
ACATTTGTGT TCTTCACATA TTGGATCAAA ATATGCAGGA GGGACAGCTT CATCACCCAC CGCGCCTTCT GCGACGCGCT
GGCGCAGGAG AACGCGCGCA TGCCGCCCAT CGGCGCCGGC GTATACGGCG GCGCCGGCAA CATGACACTT GGGCTCACCG
GCATGGCCGC CCCGCAACTT CCCGCCGGCT TCCCTGATCA GGCCGGCCAG CCGTCGGCGT CGGCCGGCGA TGTCCTCCGC
CTCGGCGGCG GCAGCAATGG CGCCTCTCAG TTTGATCACC TCATGGCCTC GTCGTCGGGC TCCTCCATGT TCCGCTCGCA
GGGATCGTCG TCCTCCTCGT TCTACCTCGC CAATGGCGCC GCCCATCATG CTCCCGCTCA GGACTTCGGC CCGGAGGACG
GCCAGTCTCA GGCCGGCCAG GGCTCGCTGC TCCACGGCAA GCCGGCGGCG TTCCATGACC TGATGCAGCT CCCCGTGCAG
CACCAGCAAA GCGGCAATGG TAACCTCCTC AACCTTGGCT TCTTCTCCGG CAGCAATGGC GGCGTCGACC AGTTCAACGG
CGGCGCTGGA AACGGCGGGC AGGGCAGCAT CGTTACTTCT AGCGGCCTCG CCGGCAACCA CGGCGGCGGC GGCGGCGGCT
TCCCTTCTCT GTACAACTCG TCCGAACCGG CCGGTACACT GCCGCAGATG TCGGCGACGG CGCTCTTGCA GAAGGCTGCC
CAGATGGGTG CAACGACGAG CAGCTACAAC GCCGGCGGCG CCGGTGGCGC GAGCTCGCTG CTCCGTGGAG CTAGCTCCCA
CGGGATCAGC GTCGGTGAAG GGCCGGCCAA CGAGAGGTCG TCGTACCAGA ATCTCATCAT GGGCTCCATG GCGAGCGGCG
GCGGTGGCGC GGGTTTCGCC GGTAGCTTCT CCGGCGCGTC TGGATTCGGT GGCGCCGTCG ACGACGGCAA GCTGAGCACG
AGGGACTTCC TCGGCGTCGG CGTCGTCCAG GGCATCAGCG GCTCGGCGGC AATGGGGCCG CCGCGCCATG GCGCGGCCGG
CCTCCACGTC GGCTCACTGG ACCCGGCAAA CATGAACTGA AGTCATCACA GAGAAGAAAA AAAACAATAG AAGACGGAAG
GAGATGATCA TGCTGCTAAT TTCATTTCAT CATATCAGAA TTAGTCAAGA AACTGGAGGT AATTAATTAA GAAGAGAAAA
GCGATTTCAA TCCATGCAAG ATGGATGTTT CTGGGGAAAT CTGGAGCTGT TAATGGTGAG TCGTAGTTGC TAGCTAGCTA
GCCAGAGCTG GGAGGAATAA TAATAATACC TGGATTAAGT GGCCAGAACT TAATTTTGTA CCGGTACATT TCGTTTGTTT
TTCATGTACT TTTGGCAGGG AAATGGGTCT CTTTTGATGT GAAGTCATCA TGTGAAGGCC TGACCCCAGA CTAGAATCAA
TTCAAGCGCG CGCTGTGCCT GGATTAATTA ATCTTGGAGT TTTATTGC

Locus: Os09g0555700

Loading...

Locus: Os09g0555700

Loading...