Os09t0556700-01

Locus

Os09g0556700

Description

SET domain domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET37, SDG732

Oryzabase Gene Name Synonym(s)

SET protein 37

Transcript Evidence

AK112101 (DDBJ, Best hit)

Protein Evidence

B9G507 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

SET domain (IPR001214)

Zinc finger, PHD-type (IPR001965)

Post-SET domain (IPR003616)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, PHD-type, conserved site (IPR019786)

Zinc finger, PHD-finger (IPR019787)

Full-length cDNA

002-110-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0556700-01)

Others

Oryzabase (13400)

Transcript

1727 bp

>Os09t0556700-01 SET domain domain containing protein.
AGAGGTGTGAAGAATTTACAAATGAATCAGCATGCAGTCCTTGTGGCGATAAACACGCTG
CGGTTCAAGCCTGTGTAACAAAATTTGAAAGATATATACAAAGGCCTAGTTTAGATGCTT
CATGTTGTGTTTGTGGTATCTCAAACCTGGAGCCTTCCAATCAGTTGATAGAGTGCAGCA
AGTGCTTTATCAAGGTGCACCAAGCTTGCTATGGTGTTCTAAAAGTTCCAAGAGGACAAT
GGTTCTGTAAGCCCTGCAAGATCAATACCCAGGACACAGTCTGTGTTCTGTGTGGTTATG
GAGGTGGAGCTATGACAAGGGCATTGAAAGCCCAGAATATTCTCAAAAGCTTGCTGAGGG
GTATTGCAACTGCAAAAAGATCAGATAAATATGTTTATTCATCAGGAAATGTGAACAGTG
AGTGTACAAGCAAGTTACATGGGGAATATGTCAGGCATGATTCATTTAATGGACACAGAT
CAAGAAGCTTCAATGCTATATCTTCTTTTGGTATAAAAGAAGCTTCAATAGGTAGTGCAC
GTGGGGACATTATCAGCAAGTCGTGGACCTCTAATCGCAATTCCAGTCTACTTGGTCCAC
GAACAAGGCAGTGGGTTCATGTGGTCTGTGGGTTGTGGACACCTGGTACAAAATGCCCAA
ATACAATCACAATGAGTGCTTTTGATATATCAGGGGCTTCACCTGCCAAAAGAAATACCG
AATGCTCAATGTGTAACAGAACTGGGGGCTCATTTATGGGGTGTCGTGATGTTAATTGCT
CAGTTCTCTTTCATCCTTGGTGTGCTCATCAGAGGGGTTTGTTGCAAAGTGAGCCAGAAG
GCGAGCATAATGAAAATGTTGGTTTTTATGGGAGATGCCTGGATCATGCTATGCTTGATC
CTAATCATGTTAATCCTAAGAAGGAATGCTTGAGGAGCAATGACTGGACATGTGCACGTA
CTGAGGTTTTTAGAGGCCGAAAGGGAGACTCATTTGGTGCTAATCGTAGCAGGAAACCAG
AAGAGAAGTTTGGTGAGTGCAGTGTTTCCCAAGAACAGATCAATGCTTGGATACGCATAA
ATGGATCGAAATCTTGCATGAGAGGACAGAAGGAATATGTCCACTACAAGCAGTTAAAGG
GATGGAAGCATTTGGTAGTGTACAAATCTAGCATTCATGGGCTTGGTCTCTACACATCGG
AGTTTATTCCACGTGGCTCTATGGTTGTACAGTATGTTGGTGAAATTGTTGGGCAATGCG
TTGCTGACAAAAGAGAGATTGAATACCAGTCCGGGAAACGGCAGCAATATAAGAGTGCTT
GTTACTTCTTCAAGATTGGAAAGGAACATATCATCGATGCCACCCGCAAGGGTGGGATCG
CAAGATTCATCAACCACTCTTGCCAACCAAACTGTGTCGCAAAAATAATCTCAGTAAGGA
ACGAGAAGAAGGTAGTGTTCTTCGCGGAACGCCACATAAATCCGGGGGAGGAAATTACCT
ACGATTATCACTTCAACCGAGAAGATGAAGGGCAAAGAATCCCCTGCTTCTGTAGATCGA
GAGGCTGCAGGAGATATCTGAACTAAGATAGTGTACTTCGGTCGTATGTTTGTAGTGCTG
TTTAAACATTGTAATGTGCGCACTGTATATATGAATAAACTGTAGGGACTTAATCTGGCA
CTGATAATTTAGACATCCAAACTTAAATTTAGAATGGATTTAGAATT

CDS

1584 bp

>Os09t0556700-01 SET domain domain containing protein.
AGGTGTGAAGAATTTACAAATGAATCAGCATGCAGTCCTTGTGGCGATAAACACGCTGCG
GTTCAAGCCTGTGTAACAAAATTTGAAAGATATATACAAAGGCCTAGTTTAGATGCTTCA
TGTTGTGTTTGTGGTATCTCAAACCTGGAGCCTTCCAATCAGTTGATAGAGTGCAGCAAG
TGCTTTATCAAGGTGCACCAAGCTTGCTATGGTGTTCTAAAAGTTCCAAGAGGACAATGG
TTCTGTAAGCCCTGCAAGATCAATACCCAGGACACAGTCTGTGTTCTGTGTGGTTATGGA
GGTGGAGCTATGACAAGGGCATTGAAAGCCCAGAATATTCTCAAAAGCTTGCTGAGGGGT
ATTGCAACTGCAAAAAGATCAGATAAATATGTTTATTCATCAGGAAATGTGAACAGTGAG
TGTACAAGCAAGTTACATGGGGAATATGTCAGGCATGATTCATTTAATGGACACAGATCA
AGAAGCTTCAATGCTATATCTTCTTTTGGTATAAAAGAAGCTTCAATAGGTAGTGCACGT
GGGGACATTATCAGCAAGTCGTGGACCTCTAATCGCAATTCCAGTCTACTTGGTCCACGA
ACAAGGCAGTGGGTTCATGTGGTCTGTGGGTTGTGGACACCTGGTACAAAATGCCCAAAT
ACAATCACAATGAGTGCTTTTGATATATCAGGGGCTTCACCTGCCAAAAGAAATACCGAA
TGCTCAATGTGTAACAGAACTGGGGGCTCATTTATGGGGTGTCGTGATGTTAATTGCTCA
GTTCTCTTTCATCCTTGGTGTGCTCATCAGAGGGGTTTGTTGCAAAGTGAGCCAGAAGGC
GAGCATAATGAAAATGTTGGTTTTTATGGGAGATGCCTGGATCATGCTATGCTTGATCCT
AATCATGTTAATCCTAAGAAGGAATGCTTGAGGAGCAATGACTGGACATGTGCACGTACT
GAGGTTTTTAGAGGCCGAAAGGGAGACTCATTTGGTGCTAATCGTAGCAGGAAACCAGAA
GAGAAGTTTGGTGAGTGCAGTGTTTCCCAAGAACAGATCAATGCTTGGATACGCATAAAT
GGATCGAAATCTTGCATGAGAGGACAGAAGGAATATGTCCACTACAAGCAGTTAAAGGGA
TGGAAGCATTTGGTAGTGTACAAATCTAGCATTCATGGGCTTGGTCTCTACACATCGGAG
TTTATTCCACGTGGCTCTATGGTTGTACAGTATGTTGGTGAAATTGTTGGGCAATGCGTT
GCTGACAAAAGAGAGATTGAATACCAGTCCGGGAAACGGCAGCAATATAAGAGTGCTTGT
TACTTCTTCAAGATTGGAAAGGAACATATCATCGATGCCACCCGCAAGGGTGGGATCGCA
AGATTCATCAACCACTCTTGCCAACCAAACTGTGTCGCAAAAATAATCTCAGTAAGGAAC
GAGAAGAAGGTAGTGTTCTTCGCGGAACGCCACATAAATCCGGGGGAGGAAATTACCTAC
GATTATCACTTCAACCGAGAAGATGAAGGGCAAAGAATCCCCTGCTTCTGTAGATCGAGA
GGCTGCAGGAGATATCTGAACTAA

Protein

528 aa

>Os09t0556700-01 SET domain domain containing protein.
RCEEFTNESACSPCGDKHAAVQACVTKFERYIQRPSLDASCCVCGISNLEPSNQLIECSK
CFIKVHQACYGVLKVPRGQWFCKPCKINTQDTVCVLCGYGGGAMTRALKAQNILKSLLRG
IATAKRSDKYVYSSGNVNSECTSKLHGEYVRHDSFNGHRSRSFNAISSFGIKEASIGSAR
GDIISKSWTSNRNSSLLGPRTRQWVHVVCGLWTPGTKCPNTITMSAFDISGASPAKRNTE
CSMCNRTGGSFMGCRDVNCSVLFHPWCAHQRGLLQSEPEGEHNENVGFYGRCLDHAMLDP
NHVNPKKECLRSNDWTCARTEVFRGRKGDSFGANRSRKPEEKFGECSVSQEQINAWIRIN
GSKSCMRGQKEYVHYKQLKGWKHLVVYKSSIHGLGLYTSEFIPRGSMVVQYVGEIVGQCV
ADKREIEYQSGKRQQYKSACYFFKIGKEHIIDATRKGGIARFINHSCQPNCVAKIISVRN
EKKVVFFAERHINPGEEITYDYHFNREDEGQRIPCFCRSRGCRRYLN*

5'UTR

chr09:22131586..22131587 (+ strand) : 2 bp

CDS

chr09:22131588..22131676 (+ strand) : 89 bp

chr09:22131806..22131908 (+ strand) : 103 bp

chr09:22131984..22132067 (+ strand) : 84 bp

chr09:22132428..22132868 (+ strand) : 441 bp

chr09:22133044..22133139 (+ strand) : 96 bp

chr09:22133289..22133438 (+ strand) : 150 bp

chr09:22133524..22133667 (+ strand) : 144 bp

chr09:22133807..22133920 (+ strand) : 114 bp

chr09:22134014..22134196 (+ strand) : 183 bp

chr09:22134294..22134338 (+ strand) : 45 bp

chr09:22134451..22134585 (+ strand) : 135 bp

3'UTR

chr09:22134586..22134726 (+ strand) : 141 bp

FASTA

>Os09t0556700-01 class=Sequence position=chr09:22131586..22134726 (+ strand)
AGAGGTGTGA AGAATTTACA AATGAATCAG CATGCAGTCC TTGTGGCGAT AAACACGCTG CGGTTCAAGC CTGTGTAACA
AAATTTGAAA GGTTGTAACT CCAGGTGCAT TCTACAGATT TCCTTTGAAG GATATGTTCC ATAGAAAATA TTTCGTTTTT
ATTAATTTAT CTTGCTTTTA CAGACTGATC TGACAAAGTT CTGCATAATA CCTTATGCAG ATATATACAA AGGCCTAGTT
TAGATGCTTC ATGTTGTGTT TGTGGTATCT CAAACCTGGA GCCTTCCAAT CAGTTGATAG AGTGCAGCAA GTGCTTTATC
AAGGTTTGTC ATATTCCCTT ACCAGAACCT AGTACTGGAG TCTATTCACA TAGAGCCTTG CATTTTTTTT TTCTGTAGGT
GCACCAAGCT TGCTATGGTG TTCTAAAAGT TCCAAGAGGA CAATGGTTCT GTAAGCCCTG CAAGATCAAT ACCCAGGACA
CAGTAAGAAA ATTCAATTTC AGAGTAGTTT CATTTAAGGC ATTTAATAGG GCATGATGTA GCCATGTAGG CCAGAACAGC
CATCTTTGTG CTTGCAGATT ACTGTGTGCA AGCACTATAG AATTTTTCAC TGATTCTTTT AGGGCTattt gtagaatgaa
gcttttattg aaatcaagat aattacatca aggtgataca aCCATTTAGG GATACACTGC TGGTATAGAT GTATGGACGC
TGCACTAGCA TGGAAAATAC TTCAGTCAAA ATTAATCTTA CTAACACTAA CATCCTCATT GTTAGATACA TTTAGTAGTG
ATTAATTGTA TATCGGTATC TCTTTACGTT TTCCTTTGCC AGGTCTGTGT TCTGTGTGGT TATGGAGGTG GAGCTATGAC
AAGGGCATTG AAAGCCCAGA ATATTCTCAA AAGCTTGCTG AGGGGTATTG CAACTGCAAA AAGATCAGAT AAATATGTTT
ATTCATCAGG AAATGTGAAC AGTGAGTGTA CAAGCAAGTT ACATGGGGAA TATGTCAGGC ATGATTCATT TAATGGACAC
AGATCAAGAA GCTTCAATGC TATATCTTCT TTTGGTATAA AAGAAGCTTC AATAGGTAGT GCACGTGGGG ACATTATCAG
CAAGTCGTGG ACCTCTAATC GCAATTCCAG TCTACTTGGT CCACGAACAA GGCAGTGGGT TCATGTGGTC TGTGGGTTGT
GGACACCTGG TACAAAATGC CCAAATACAA TCACAATGAG TGCTTTTGAT ATATCAGGGG CTTCACCTGC CAAAAGAAAT
ACCGTGAGTT CCCTACATGC ATATTCTTTT GAACTTCATT GAAAATATGT TTCCTGTAAA TTGAAAGTGC ATCCAATGCC
AAGTGCTGGC ATTGGCCATG GGTTTCCTTT CATCCTGCAC CCGATTATTT AGTCCTAATG AACTTAATCT TCATTATTGC
TAATGTTTTT GTTGTCAGGA ATGCTCAATG TGTAACAGAA CTGGGGGCTC ATTTATGGGG TGTCGTGATG TTAATTGCTC
AGTTCTCTTT CATCCTTGGT GTGCTCATCA GAGGGTATGA TATCCACTCA TAATAAGCTA TTTGACCTAT ATATTATCAC
ATTGATTTAC TGTATGCTCA TAAGAAATAT TCTGCAATCT TGGTTAAAAC TTATTGTTAT CTCAACACTG TAAATCTGAA
TGTTGCTCAT GATATCACAA TAGGGTTTGT TGCAAAGTGA GCCAGAAGGC GAGCATAATG AAAATGTTGG TTTTTATGGG
AGATGCCTGG ATCATGCTAT GCTTGATCCT AATCATGTTA ATCCTAAGAA GGAATGCTTG AGGAGCAATG ACTGGACATG
TGCACGTACT GAGGTAATAT ATTTGTTTTA CCTTTGTACT GCTTGAAAAA TTAGAATCCT AACAAGTGAC AACTTCCTTT
GTCATTCTTC TGAAACAGGT TTTTAGAGGC CGAAAGGGAG ACTCATTTGG TGCTAATCGT AGCAGGAAAC CAGAAGAGAA
GTTTGGTGAG TGCAGTGTTT CCCAAGAACA GATCAATGCT TGGATACGCA TAAATGGATC GAAATCTTGC ATGAGAGGAC
AGGTAACTTC TAATCCTTCA CTGCAATGCA GTTGGTTATC TTCAATATAG TACATTGTAA TGTACTCTGC TTTAGCGGGG
TATCAAAGTT TGCATGTACA TACTGGATGA GCTGTTTACA TGTCTTCATT CTCATTTTTA GAAGGAATAT GTCCACTACA
AGCAGTTAAA GGGATGGAAG CATTTGGTAG TGTACAAATC TAGCATTCAT GGGCTTGGTC TCTACACATC GGAGTTTATT
CCACGTGGCT CTATGGTAAT TCATCAGTTA TTCTTTCCTT AGTCGATAAT CTGACACAAG AATTTAGCAA ATGAAGAAAT
TGTTAACTTC TGCATGAAAA TATTTCAGGT TGTACAGTAT GTTGGTGAAA TTGTTGGGCA ATGCGTTGCT GACAAAAGAG
AGATTGAATA CCAGTCCGGG AAACGGCAGC AATATAAGAG TGCTTGTTAC TTCTTCAAGA TTGGAAAGGA ACATATCATC
GATGCCACCC GCAAGGGTGG GATCGCAAGA TTCATCAACC ACTCTTGCCA AGTAACAAAT AATATGCTCA TCTGTGTCTT
TTTTCGTCCA TCTAAAACTG AATGTTTCTA ATGCATGTTT TGTTTTCTTC CAATCTTTGC TGGATCAGCC AAACTGTGTC
GCAAAAATAA TCTCAGTAAG GAACGAGAAG AAGGTACCCC TTTTCTTTAT TTCGATGTTG TCGTTTCAAA ATATTCGCCC
CAGCCCTCTT TCTTTCCTGG CAAATTTATC TGTTTCTATT CTAATGTGTT TTTATCATTG TCCAGGTAGT GTTCTTCGCG
GAACGCCACA TAAATCCGGG GGAGGAAATT ACCTACGATT ATCACTTCAA CCGAGAAGAT GAAGGGCAAA GAATCCCCTG
CTTCTGTAGA TCGAGAGGCT GCAGGAGATA TCTGAACTAA GATAGTGTAC TTCGGTCGTA TGTTTGTAGT GCTGTTTAAA
CATTGTAATG TGCGCACTGT ATATATGAAT AAACTGTAGG GACTTAATCT GGCACTGATA ATTTAGACAT CCAAACTTAA
ATTTAGAATG GATTTAGAAT T

Locus: Os09g0556700

Loading...

Locus: Os09g0556700

Loading...