Os09t0565200-02

Locus

Os09g0565200

Description

Chloroplast ribonucleoprotein, Drought and cold stress tolerance, Regulation of chloroplast mRNA stability

RAP-DB Gene Symbol Synonym(s)

OsCRP1

RAP-DB Gene Name Synonym(s)

CHLOROPLAST RNA-BINDING PROTEIN 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK069121

AK104354

Protein Evidence

Q650W6

Literature

PMID: 33562320

Note

Manual Curation

February 22, 2021

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Nucleotide-binding alpha-beta plait domain superfamily (IPR012677)

RNA-binding domain superfamily (IPR035979)

RNA recognition motif domain (IPR000504)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

Full-length cDNA

J023007A14 (Online Clone Ordering)

001-034-H01 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0565200-02)

RiceXPro (AK069121)

Others

Oryzabase (17603)

KEGG (Os09t0565200-02)

Transcript

1288 bp

>Os09t0565200-02 Chloroplast ribonucleoprotein, Drought and cold stress tolerance, Regulation of chloroplast mRNA stability
GATTCTCTTccattccattcccaaccatggcctcctccatcgccatgtccctccgctccc
tcgccgccaccgacgccttcctccccaagccctccccctcctccgccccattcctcctcc
tcctctccccgtccaccccgcgcctccgcctccacctccacctccgcTCCACCCGCCGCC
TCCCGCTCGCGCCGCTCGCCGCGTCCGACTCCTTCGAATCCGCTTCGTCCTCCTCCGCCG
CCGCGCTCGACTTCGCTGAGCCAGGTGCCGCCGAGGAGTCCGACGTGCCGGAGGAGTCTG
ACCAGGAAGAGGAGGGGTACGCGCCGGAGGCCGAGGAGGAGGCGGAGGCGGATGAGGAGG
TGGAGGAGGAAGCCGTCGAGGCCTCCGCGGAAGTTGCGGAGGAGGCCGAGGACGTAGAGG
AGGTCGGCGAGTACGTGGAGCCGCCCGAGGAGGCCAAGGTCTACGTCGGGAACCTACCCT
ACGACATCGACAGCGAGCGCCTCGCCCAGCTCTTCGAACAGGCCGGCATCGTCGAGGTCT
CCGAGGTCATCTACAACAGAGAAACAGATCGGAGTCGTGGATTTGGATTTGTCACCATGA
GCACCGTTGAGGAGGCTGAGAAGGCTGTGGAGATGTTCCATCGCTACGATGTTGATGGGA
GGCTTCTGACTGTAAACAAGGCAGCTCCTAGAGGCGCTCGGGTGGAAAGACCTCCCCGTC
AGTTTGGGCCTTCTTTCAGGATTTATGTGGGCAATCTCCCTTGGCAAGTGGATGACTCTA
GGTTGGTACAGCTGTTCAGCGAGCATGGCAAAGTAGTCGACGCCAGAGTTGTGTATGACA
GAGAAACTGGGCGTTCACGAGGATTTGGTTTTGTAACAATGGCGACACAGGAAGAATTGG
ACGACGCTATTGCAGCCCTCGATGGACAGAGTTTGGATGGCCGTGCGCTGAGAGTGAATG
TTGCAGAGGAGCGACCACCGCGCCGAGGCTTTTAATGGGATAGCAGGCTTTGTGGGGGTT
TAACAGCATCGGAGGCATCATAGCACGTCTGATACTGGTTTAGTCCCTCAAATAGTAGCT
TTCTTGCGATTCTTGGTTCTGTATCCTCCCAAGTCCTTTCTCATGCCTGCTGTTTACTGC
TCCTTTCTTGTTAACTGTTGGTTGTGGCCACGAGTTGATGCACGTAGGCTACTGTTATGA
TGCCCCTCTACCCCAATTTGTCGATGCATCCAAAAGTTTTGTCTAACATTTATCTATTTA
AGCAAAAGAAGAGCATGGTGTGTGTGGC

CDS

969 bp

>Os09t0565200-02 Chloroplast ribonucleoprotein, Drought and cold stress tolerance, Regulation of chloroplast mRNA stability
atggcctcctccatcgccatgtccctccgctccctcgccgccaccgacgccttcctcccc
aagccctccccctcctccgccccattcctcctcctcctctccccgtccaccccgcgcctc
cgcctccacctccacctccgcTCCACCCGCCGCCTCCCGCTCGCGCCGCTCGCCGCGTCC
GACTCCTTCGAATCCGCTTCGTCCTCCTCCGCCGCCGCGCTCGACTTCGCTGAGCCAGGT
GCCGCCGAGGAGTCCGACGTGCCGGAGGAGTCTGACCAGGAAGAGGAGGGGTACGCGCCG
GAGGCCGAGGAGGAGGCGGAGGCGGATGAGGAGGTGGAGGAGGAAGCCGTCGAGGCCTCC
GCGGAAGTTGCGGAGGAGGCCGAGGACGTAGAGGAGGTCGGCGAGTACGTGGAGCCGCCC
GAGGAGGCCAAGGTCTACGTCGGGAACCTACCCTACGACATCGACAGCGAGCGCCTCGCC
CAGCTCTTCGAACAGGCCGGCATCGTCGAGGTCTCCGAGGTCATCTACAACAGAGAAACA
GATCGGAGTCGTGGATTTGGATTTGTCACCATGAGCACCGTTGAGGAGGCTGAGAAGGCT
GTGGAGATGTTCCATCGCTACGATGTTGATGGGAGGCTTCTGACTGTAAACAAGGCAGCT
CCTAGAGGCGCTCGGGTGGAAAGACCTCCCCGTCAGTTTGGGCCTTCTTTCAGGATTTAT
GTGGGCAATCTCCCTTGGCAAGTGGATGACTCTAGGTTGGTACAGCTGTTCAGCGAGCAT
GGCAAAGTAGTCGACGCCAGAGTTGTGTATGACAGAGAAACTGGGCGTTCACGAGGATTT
GGTTTTGTAACAATGGCGACACAGGAAGAATTGGACGACGCTATTGCAGCCCTCGATGGA
CAGAGTTTGGATGGCCGTGCGCTGAGAGTGAATGTTGCAGAGGAGCGACCACCGCGCCGA
GGCTTTTAA

Protein

323 aa

>Os09t0565200-02 Chloroplast ribonucleoprotein, Drought and cold stress tolerance, Regulation of chloroplast mRNA stability
MASSIAMSLRSLAATDAFLPKPSPSSAPFLLLLSPSTPRLRLHLHLRSTRRLPLAPLAAS
DSFESASSSSAAALDFAEPGAAEESDVPEESDQEEEGYAPEAEEEAEADEEVEEEAVEAS
AEVAEEAEDVEEVGEYVEPPEEAKVYVGNLPYDIDSERLAQLFEQAGIVEVSEVIYNRET
DRSRGFGFVTMSTVEEAEKAVEMFHRYDVDGRLLTVNKAAPRGARVERPPRQFGPSFRIY
VGNLPWQVDDSRLVQLFSEHGKVVDARVVYDRETGRSRGFGFVTMATQEELDDAIAALDG
QSLDGRALRVNVAEERPPRRGF*

5'UTR

chr09:22507501..22507526 (- strand) : 26 bp

CDS

chr09:22506982..22507500 (- strand) : 519 bp

chr09:22506400..22506501 (- strand) : 102 bp

chr09:22505600..22505881 (- strand) : 282 bp

chr09:22505360..22505425 (- strand) : 66 bp

3'UTR

chr09:22505067..22505359 (- strand) : 293 bp

FASTA

>Os09t0565200-02 class=Sequence position=chr09:22505067..22507526 (- strand)
GATTCTCTTc cattccattc ccaaccatgg cctcctccat cgccatgtcc ctccgctccc tcgccgccac cgacgccttc
ctccccaagc cctccccctc ctccgcccca ttcctcctcc tcctctcccc gtccaccccg cgcctccgcc tccacctcca
cctccgcTCC ACCCGCCGCC TCCCGCTCGC GCCGCTCGCC GCGTCCGACT CCTTCGAATC CGCTTCGTCC TCCTCCGCCG
CCGCGCTCGA CTTCGCTGAG CCAGGTGCCG CCGAGGAGTC CGACGTGCCG GAGGAGTCTG ACCAGGAAGA GGAGGGGTAC
GCGCCGGAGG CCGAGGAGGA GGCGGAGGCG GATGAGGAGG TGGAGGAGGA AGCCGTCGAG GCCTCCGCGG AAGTTGCGGA
GGAGGCCGAG GACGTAGAGG AGGTCGGCGA GTACGTGGAG CCGCCCGAGG AGGCCAAGGT CTACGTCGGG AACCTACCCT
ACGACATCGA CAGCGAGCGC CTCGCCCAGC TCTTCGAACA GGCCGGCATC GTCGAGGTCT CCGAGGTGTG ACCCTCTCCA
TTCTCCGCGC TCTTTCATAT GCAAAACTAA AATGACCCAC TGAACTTCAG TTCAGTACTT CAGTGGACTC CTGTGCAAAT
GCACTTCTTT TATTTTTCAT TTACCTGCTT GGTCACTTGC TCTGTTGAAA CTTATTATAA TTTTTAATCT AGCTGGCTCA
TCTGTGTGGT AGGCTGGTAG GATACTAGTG TTTACAAGAA CTGTCCCTGT TTTACTGTTA GGCTGCGGAT TACAGTTATT
TTTGTGTTTC ACATTTAAAA CCTGCAAGAT GGGCAGCTGT GGCTTATTTA TCTCTGTGGG CATCCTACTT GTGTTATGAA
AGATGCCTTT GATATTTACC TTCCCGTCTT TAGGGTATTC ATTTATTTAT TATGTGAACC GTATAGAGGC AGTTAGACAA
AATATTAGGA TATGCATGGT TTTGTTCTTT TGATCAGAAA TGAACCTCTA TTTTCGCGTG TTCAGGTCAT CTACAACAGA
GAAACAGATC GGAGTCGTGG ATTTGGATTT GTCACCATGA GCACCGTTGA GGAGGCTGAG AAGGCTGTGG AGATGTTCCA
TCGCTACGTG AGTCTCTCTC TATCTAAATT GCCCTATTTC CCCTCAACAT TTTCTTCATT TTGTTGAAGC TCAAGATAAC
CTGATTTCCT ATGTTAGTTA CAGCTCATGT TCATTGTGTA CACAGTAATT TCTGTACTTG CAGTATGCAT GTAACTGGCT
TCAAACAGTT TGCATTTGTT TTCCTTATTT CAACTATGGC ATTGTGGTAT TGGCGTTTCA TTCTGAATGA TCATGGATGG
ACATGATAGT TTCTCTTAGT TTCTCATTCA AGGGTACACT ATAATGTTTA AGTGAAAAAG AAAGGGAGGG TCATATTAGG
CATATGTCAT CCTTATTGAC TGATATGACT ATGAGGAATA ACAATTCTAA AGTTGTAAGA GCTGTGATTT CTATGTTTAA
CTTTCTTTGA CAGACCTCTT AAAACTTGTT CTTCTGTTGC TACTAAATTT TTAAAAGTAT GGTAGTATGA TGTAAAGAAT
GTACAGATTT CATGCTTTGA TGATAAACCT TTTTAATGTG GATAGGATGT TGATGGGAGG CTTCTGACTG TAAACAAGGC
AGCTCCTAGA GGCGCTCGGG TGGAAAGACC TCCCCGTCAG TTTGGGCCTT CTTTCAGGAT TTATGTGGGC AATCTCCCTT
GGCAAGTGGA TGACTCTAGG TTGGTACAGC TGTTCAGCGA GCATGGCAAA GTAGTCGACG CCAGAGTTGT GTATGACAGA
GAAACTGGGC GTTCACGAGG ATTTGGTTTT GTAACAATGG CGACACAGGA AGAATTGGAC GACGCTATTG CAGCCCTCGA
TGGACAGGTA AGTGTATATT CGATTCACTG ACATCTTTAC AACTGGGATT AAGCAACCAC TGGTAATCAT TGTTACATGG
AGGCTGTGAA CTGATGCTAA TTGACTCATA CCATCAATAA CTTTTGTGTC TTTTAACTTT GCTTACCCAA GTAACACACT
TTTCCAATCT GAATTCAACA GAGTTTGGAT GGCCGTGCGC TGAGAGTGAA TGTTGCAGAG GAGCGACCAC CGCGCCGAGG
CTTTTAATGG GATAGCAGGC TTTGTGGGGG TTTAACAGCA TCGGAGGCAT CATAGCACGT CTGATACTGG TTTAGTCCCT
CAAATAGTAG CTTTCTTGCG ATTCTTGGTT CTGTATCCTC CCAAGTCCTT TCTCATGCCT GCTGTTTACT GCTCCTTTCT
TGTTAACTGT TGGTTGTGGC CACGAGTTGA TGCACGTAGG CTACTGTTAT GATGCCCCTC TACCCCAATT TGTCGATGCA
TCCAAAAGTT TTGTCTAACA TTTATCTATT TAAGCAAAAG AAGAGCATGG TGTGTGTGGC 

Locus: Os09g0565200

Loading...

Locus: Os09g0565200

Loading...