Os09t0567300-01

Locus

Os09g0567300

Description

Monodehydroascorbate reductase, Tolerance to ROS-induced oxidative stress

RAP-DB Gene Symbol Synonym(s)

MDHAR, OsMDHAR, OsMDAR3, OsMDHAR3

RAP-DB Gene Name Synonym(s)

cytosolic monodehydroascorbate reductase, monodehydroascorbate reductase

CGSNL Gene Symbol

MDHAR3

CGSNL Gene Name

MONODEHYDROASCORBATE REDUCTASE 3

Oryzabase Gene Symbol Synonym(s)

MDHAR, OsMDHAR, OsMDAR3, MDAR3, OsMDHAR3, MDHAR1, OsMDHAR1

Oryzabase Gene Name Synonym(s)

cytosolic monodehydroascorbate reductase, monodehydroascorbate reductase

Transcript Evidence

AK071558

D85764

Protein Evidence

Q652L6

Q9XFZ3

Literature

PMID: 27652777

PMID: 27392090

Note

Manual Curation

November 21, 2016

Gene Ontology (GO)

Biological Process: cell redox homeostasis (GO:0045454)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Functional domain (InterPro)

FAD/NAD(P)-binding domain (IPR023753)

FAD/NAD-linked reductase, dimerisation domain (IPR016156)

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (IPR004099)

Full-length cDNA

J023100J06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0567300-01)

RiceXPro (AK071558)

Others

Oryzabase (17790)

KEGG (Os09t0567300-01 (EC:1.6.5.4))

Transcript

1667 bp

>Os09t0567300-01 Monodehydroascorbate reductase, Tolerance to ROS-induced oxidative stress
GCTCGCTCGTGCTGGCCCACATATCAGTGTATGCACATAGAGTGGGTGGGAATCTCCATC
CGTTTGGGAACACACAACACAACAACTACCACCCCCACTCCGCTCCTTCCTTCCTTCCCG
CATTTGGATTTACCCCCAAATCTTCTCCAAGTCCAATCGACCTCATTTCATTCGATTCAT
CGATCGCTCGGCGCGGCTTAGGGTTTTTGGCGGCAGCGATGGCGTCGGAGAAGCACTTCA
AGTACGTCATCCTCGGCGGCGGCGTCGCAGCGGGATATGCGGCACGGGAGTTCGCCAAGC
AGGGTGTTAAGCCAGGGGAGCTCGCCATCATCTCCAAGGAGGCCGTGGCTCCTTATGAGC
GCCCTGCTCTCAGCAAGGGATACCTCTTTCCTCAGAATGCTGCAAGACTCCCAGGATTTC
ATGTGTGTGTCGGCAGTGGAGGAGAGAGGCTTTTGCCCGAATGGTACTCAGAGAAAGGCA
TTGAGTTGATCCTGAGCACTGAAATTGTCAAAGCTGATCTTGCCTCCAAGACTTTGACTA
GTGCAGTTGGAGCAACCTTTACATATGAGATTTTGATCATTGCAACTGGCTCCTCAGTCA
TCAAGCTATCAGATTTTGGTACTCAAGGAGCTGATTCCAACAACATTTTATATCTAAGGG
AAGTAGATGATGCTGACAAGCTGGTTGCAGCTATCCAAGCAAAGAAGGGTGGAAAGGCAG
TTATTGTAGGAGGAGGTTACATTGGTCTAGAACTTAGTGCTGCATTGAAGATCAATGATT
TTGATGTCACGATGGTGTTTCCTGAACCTTGGTGCATGCCTCGTCTCTTCACTGCTGATA
TCGCGGCTTTCTATGAGAGTTACTACACTAACAAAGGAGTTAAGATCGTGAAGGGTACAG
TAGCTGTTGGTTTTGATGCTGATGCTAATGGTGATGTCACAGCAGTTAACCTGAAGAATG
GCAGTGTGCTTGAAGCTGATATTGTTGTTGTTGGTGTTGGGGGCAGACCGCTGACTACTC
TCTTTAAAGGTCAAGTTGCTGAGGAGAAAGGTGGAATTAAGACCGATGCTTTCTTTGAAA
CAAGTGTTCCTGGAGTCTATGCTGTCGGTGATGTGGCCACCTTCCCCATGAAGATGTACA
ATGAGTTGAGGAGAGTGGAACATGTTGACCATGCTAGGAAGTCTGCAGAGCAGGCTGTAA
AGGCAATCAAGGGAAAAGAGTCCGGCGAGTCCGTTGTGGAGTATGACTATCTGCCATACT
TCTACTCCCGGTCATTCGACCTGGGATGGCAATTCTACGGCGACAACGTTGGCGACACCA
TCCTGTTCGGAGACAGTGACCCGACCTCTGCCAAGCCCAAGTTCGGGTCCTACTGGATCA
AGGACGGCAAGGTGTTGGGTGCCTTCCTGGAGGGTGGGTCACCTGATGAGAACAAGGCCA
TTGCCAAGGTCGCGAAAACTCAGCCGCCCGTTGCCAACATAGAGGAGCTCAAGAAGGAAG
GCCTCCAGTTCGCCAGCAAAATATGAGATTTTTGTAGTTTTGATGTACATTTCCACATGG
TACTCCCCCTATTGGTTTTCTGATTGTGATGCGTCTGTACTCTGTACTCCTCTTAAATAT
GGGCACTTGCTATAGCTGCTGAGATTTGAATAAAGAAGTTTTCTACT

CDS

1308 bp

>Os09t0567300-01 Monodehydroascorbate reductase, Tolerance to ROS-induced oxidative stress
ATGGCGTCGGAGAAGCACTTCAAGTACGTCATCCTCGGCGGCGGCGTCGCAGCGGGATAT
GCGGCACGGGAGTTCGCCAAGCAGGGTGTTAAGCCAGGGGAGCTCGCCATCATCTCCAAG
GAGGCCGTGGCTCCTTATGAGCGCCCTGCTCTCAGCAAGGGATACCTCTTTCCTCAGAAT
GCTGCAAGACTCCCAGGATTTCATGTGTGTGTCGGCAGTGGAGGAGAGAGGCTTTTGCCC
GAATGGTACTCAGAGAAAGGCATTGAGTTGATCCTGAGCACTGAAATTGTCAAAGCTGAT
CTTGCCTCCAAGACTTTGACTAGTGCAGTTGGAGCAACCTTTACATATGAGATTTTGATC
ATTGCAACTGGCTCCTCAGTCATCAAGCTATCAGATTTTGGTACTCAAGGAGCTGATTCC
AACAACATTTTATATCTAAGGGAAGTAGATGATGCTGACAAGCTGGTTGCAGCTATCCAA
GCAAAGAAGGGTGGAAAGGCAGTTATTGTAGGAGGAGGTTACATTGGTCTAGAACTTAGT
GCTGCATTGAAGATCAATGATTTTGATGTCACGATGGTGTTTCCTGAACCTTGGTGCATG
CCTCGTCTCTTCACTGCTGATATCGCGGCTTTCTATGAGAGTTACTACACTAACAAAGGA
GTTAAGATCGTGAAGGGTACAGTAGCTGTTGGTTTTGATGCTGATGCTAATGGTGATGTC
ACAGCAGTTAACCTGAAGAATGGCAGTGTGCTTGAAGCTGATATTGTTGTTGTTGGTGTT
GGGGGCAGACCGCTGACTACTCTCTTTAAAGGTCAAGTTGCTGAGGAGAAAGGTGGAATT
AAGACCGATGCTTTCTTTGAAACAAGTGTTCCTGGAGTCTATGCTGTCGGTGATGTGGCC
ACCTTCCCCATGAAGATGTACAATGAGTTGAGGAGAGTGGAACATGTTGACCATGCTAGG
AAGTCTGCAGAGCAGGCTGTAAAGGCAATCAAGGGAAAAGAGTCCGGCGAGTCCGTTGTG
GAGTATGACTATCTGCCATACTTCTACTCCCGGTCATTCGACCTGGGATGGCAATTCTAC
GGCGACAACGTTGGCGACACCATCCTGTTCGGAGACAGTGACCCGACCTCTGCCAAGCCC
AAGTTCGGGTCCTACTGGATCAAGGACGGCAAGGTGTTGGGTGCCTTCCTGGAGGGTGGG
TCACCTGATGAGAACAAGGCCATTGCCAAGGTCGCGAAAACTCAGCCGCCCGTTGCCAAC
ATAGAGGAGCTCAAGAAGGAAGGCCTCCAGTTCGCCAGCAAAATATGA

Protein

436 aa

>Os09t0567300-01 Monodehydroascorbate reductase, Tolerance to ROS-induced oxidative stress
MASEKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQN
AARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILI
IATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELS
AALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDV
TAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVA
TFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFY
GDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVAN
IEELKKEGLQFASKI*

5'UTR

chr09:22644685..22644902 (+ strand) : 218 bp

CDS

chr09:22644903..22644956 (+ strand) : 54 bp

chr09:22645184..22645255 (+ strand) : 72 bp

chr09:22645861..22645912 (+ strand) : 52 bp

chr09:22646033..22646113 (+ strand) : 81 bp

chr09:22646295..22646413 (+ strand) : 119 bp

chr09:22646509..22646728 (+ strand) : 220 bp

chr09:22646902..22647020 (+ strand) : 119 bp

chr09:22647112..22647237 (+ strand) : 126 bp

chr09:22647487..22647627 (+ strand) : 141 bp

chr09:22648168..22648491 (+ strand) : 324 bp

3'UTR

chr09:22648492..22648632 (+ strand) : 141 bp

FASTA

>Os09t0567300-01 class=Sequence position=chr09:22644685..22648632 (+ strand)
GCTCGCTCGT GCTGGCCCAC ATATCAGTGT ATGCACATAG AGTGGGTGGG AATCTCCATC CGTTTGGGAA CACACAACAC
AACAACTACC ACCCCCACTC CGCTCCTTCC TTCCTTCCCG CATTTGGATT TACCCCCAAA TCTTCTCCAA GTCCAATCGA
CCTCATTTCA TTCGATTCAT CGATCGCTCG GCGCGGCTTA GGGTTTTTGG CGGCAGCGAT GGCGTCGGAG AAGCACTTCA
AGTACGTCAT CCTCGGCGGC GGCGTCGCAG CGGTCTGTGC CCTCTCTCTT TTTTCGCTTG CGCCTCCCAA ATTTGCAAAT
CACCTTCCTT CCGTCCTTCT CGCCCTGCCG CCCTGGGAGG GGAGTAGGCT GCGGGAGTTC ACTGCAAGAT CGATGTGGGA
TTCATTCGCT TGGATCCTTT TATTTGATCT TGGTCTGTTC CGGATCTCGT CGAAAGTACG GTTTTTCCTG TTCCTAATTT
CTCTCTGAAT ATTTTGCAGG GATATGCGGC ACGGGAGTTC GCCAAGCAGG GTGTTAAGCC AGGGGAGCTC GCCATCATCT
CCAAGGAGGC CGTATGCTCT CTTTCTCTCT CACACACATA CGCGCGCGCG CGGGTTGACA CACAAAATGC TCTCTTCTGC
TCTCTCTCTT TCAATAGGTT GTTCAGGTGC TCCATATCCA TAACTGTAGT ACACCTTCAA TCGAGTTAAG ATGTCTAGTA
TGCCAGTTTT TTGTTATCCA CAAAGCATAA CAATGGCAAA TGAGTTGTGC TTATGCAATA GTTGCATACA TCAGTATGTT
AGTGGCAGGC CTCAACTATT ATTTGTTTGC TAATTACTGA ATCCACATGT TTGTACTAAA TCTTCTGTTG CCTAGGTACT
TTTACTTACT GGAACCATAC CTGTTCTTGT TGTAAGCCAC TTGTTTAAGC ATGTCGCAAT TAACCAACCT TCAATCTATT
GCTGGAATTT TGCCTACAAC AATGCTTTGC TAAAAAGAAA AACTTTGTAT TATGGAAGTT GCTTCTGAGG GCCAAAAGAA
ACAATTCTTG TAAAGCCATT TTGGCACAGC AAGAAATAGT CCTAATTTGC CCTTTGCAAG TTCTGTCATT CTGTCAATTT
TTACTTGCTT GTTCACCAAC ACAGCATTGT GTTTCTTATC AAAAGTTCTC TTTCAGGTGG CTCCTTATGA GCGCCCTGCT
CTCAGCAAGG GATACCTCTT TCCTCAGAGT AAGTCCTTAA CTTACCGTGT TCTGCCTTTT CGTGTCTGAC CTGTGCCAGC
TCTATGTCAC ATGTGGATTG ATCAATTTGT ACGATCAAAG TAACACCATT TGCATTCTCT GCGAATAGAT GCTGCAAGAC
TCCCAGGATT TCATGTGTGT GTCGGCAGTG GAGGAGAGAG GCTTTTGCCC GAATGGTACT CAGAGAAAGG TATTGACTGC
CATTTTGCTT TCTGCACCAT ATCATCTTTT AATGATTTAT TTGTCATTGT TGAGGTTAAT TACCATCAAT TTGAAATTCT
TATTTTTGCT CACCTTAGTG GAAATACGTC ATGTAATGAT TTTTTTTTAT TCTAAGCATA CTCCTGAATC ATGATTGCAT
CTGTTGGCAG GCATTGAGTT GATCCTGAGC ACTGAAATTG TCAAAGCTGA TCTTGCCTCC AAGACTTTGA CTAGTGCAGT
TGGAGCAACC TTTACATATG AGATTTTGAT CATTGCAACT GGCTCCTCAG TATGTTGTGA ACTGTGAAAT TTGTTTAATA
TCGGCTCATT GCTGTCATTA CTATCACTTG TTATTTACAT GCTCTTTTTT TATCCGCTTG TCAGGTCATC AAGCTATCAG
ATTTTGGTAC TCAAGGAGCT GATTCCAACA ACATTTTATA TCTAAGGGAA GTAGATGATG CTGACAAGCT GGTTGCAGCT
ATCCAAGCAA AGAAGGGTGG AAAGGCAGTT ATTGTAGGAG GAGGTTACAT TGGTCTAGAA CTTAGTGCTG CATTGAAGAT
CAATGATTTT GATGTCACGA TGGTGTTTCC TGAACCTTGG TGCAGTAAGT GTCACCACTC ATATTTTCGC TAACCACTGT
TCAACTACCT ACTACGCATC AGATGAAAAG AATCAGTTTT GCCCATACGA TTGACATGCA GTTATGATGT GAAACGAACT
TATAGTGGAA ACTTTCGTGA TGATGGGAAT CTGACATTGT AAAATATCTT CTTGTAGTGC CTCGTCTCTT CACTGCTGAT
ATCGCGGCTT TCTATGAGAG TTACTACACT AACAAAGGAG TTAAGATCGT GAAGGGTACA GTAGCTGTTG GTTTTGATGC
TGATGCTAAT GGTGATGTAT GTACATCTTC CAAATCCAAA ATAGCTCTGT AGCTCTCAGT GTGAATGCAA ATGACTGTCT
GCTTTCCATC GGTTCCCTAT TTACTAGGTC ACAGCAGTTA ACCTGAAGAA TGGCAGTGTG CTTGAAGCTG ATATTGTTGT
TGTTGGTGTT GGGGGCAGAC CGCTGACTAC TCTCTTTAAA GGTCAAGTTG CTGAGGAGAA AGGTGGAATT AAGGTTAGTT
TGCTTTTAAC CTGTAGGCTT GACCACAGAA GGTGCTAGGG ATGTTTCTAT CAAAGAAACA GTGTGTAAAC AACTGGACGT
TTCTTTATCA AAAAACAGCA GCTGTGCATT TGCTATTTTT CTTTTTTGTG CAAGCAACTC GTTTATAGCA TTTGGCCCAT
CTTGATTGCA TTCCTTGAAA CAATTGAGCA TGTGCATTAT TGTTTATACC TTAATATCTG GCACGCCCAA AATTGTATGC
AGACCGATGC TTTCTTTGAA ACAAGTGTTC CTGGAGTCTA TGCTGTCGGT GATGTGGCCA CCTTCCCCAT GAAGATGTAC
AATGAGTTGA GGAGAGTGGA ACATGTTGAC CATGCTAGGA AGTCTGCAGA GCAGGCTGTA AAGGTGAGGC CATTCCACTT
GTGTTTCTCT GAAATACAGT AGTTGTGACG ACTAACACCA CATAGTGGCC TGCACTTGGA TCTGACTTGA TAGTGATCTG
AGTTAAGCAA TTATTGAATT GCTCGGAAAA CCACCAAATG CTTGGTGTTC ATGAGTATCC CTGATTAGCA TGGTAGAATT
TGATCACTGA AAAATTCTTT GCACTGTCAT TCAATAATGA TTTGAATATA TTGCATGCAA GAATAACGTT AAACTGGACG
ATGTAATGTA TTGTCACATG GAATAGAATG ATCTAATGCA TAGTCATCTG ATAATGTATT ATGAAATATT GAAATTGCAC
TAAAGAATAG TGCAAACTTT GTGTTAATTT CTTTGAGTTG TCTTTGCGAG CAGTGAAATG TCAAAACCTT GGAGTTACCA
AACCACTTGG AATCCAAAAA CTTCGCTTGT GTTGATTCTG ATTACCAACA GGCAACAGTT GTGGCTACTT AACTCGGAAT
AGGGTTATCA TATCTTAGCT TGAACCCTGC ATCTTTGTTT CAGGCAATCA AGGGAAAAGA GTCCGGCGAG TCCGTTGTGG
AGTATGACTA TCTGCCATAC TTCTACTCCC GGTCATTCGA CCTGGGATGG CAATTCTACG GCGACAACGT TGGCGACACC
ATCCTGTTCG GAGACAGTGA CCCGACCTCT GCCAAGCCCA AGTTCGGGTC CTACTGGATC AAGGACGGCA AGGTGTTGGG
TGCCTTCCTG GAGGGTGGGT CACCTGATGA GAACAAGGCC ATTGCCAAGG TCGCGAAAAC TCAGCCGCCC GTTGCCAACA
TAGAGGAGCT CAAGAAGGAA GGCCTCCAGT TCGCCAGCAA AATATGAGAT TTTTGTAGTT TTGATGTACA TTTCCACATG
GTACTCCCCC TATTGGTTTT CTGATTGTGA TGCGTCTGTA CTCTGTACTC CTCTTAAATA TGGGCACTTG CTATAGCTGC
TGAGATTTGA ATAAAGAAGT TTTCTACT

Locus: Os09g0567300

Loading...

Locus: Os09g0567300

Loading...