Os09t0572900-01

Locus

Os09g0572900

Description

Dynamin-related protein 1E, Negative regulation of programmed cell death, Control of cytochrome c release

RAP-DB Gene Symbol Synonym(s)

DJLM, OsDRP1E

RAP-DB Gene Name Synonym(s)

DONGJIN-LESION MIMIC, dynamin-related protein 1E

CGSNL Gene Symbol

DJLM

CGSNL Gene Name

DONGJIN-LESION MIMIC

Oryzabase Gene Symbol Synonym(s)

DJ-LM, OsDRP1E, DRP1E

Oryzabase Gene Name Synonym(s)

dongjin-lesion mimic, dynamin-related protein 1E

Transcript Evidence

AK069270

Protein Evidence

Q650Z3

Literature

PMID: 28081268

Note

Manual Curation

June 6, 2017

Gene Ontology (GO)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Dynamin superfamily (IPR022812)

Dynamin, GTPase domain (IPR001401)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Dynamin-type guanine nucleotide-binding (G) domain (IPR030381)

Dynamin central domain (IPR000375)

GTPase effector domain (IPR020850)

Dynamin GTPase effector (IPR003130)

Dynamin, GTPase region, conserved site (IPR019762)

Experimentally confirmed subcellular location

mitochondrion (GO:0005739)

Full-length cDNA

J023013P18 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0572900-01)

RiceXPro (AK069270)

Others

Oryzabase (21594)

KEGG (Os09t0572900-01)

Transcript

2240 bp

>Os09t0572900-01 Dynamin-related protein 1E, Negative regulation of programmed cell death, Control of cytochrome c release
CTTTCTTGTCTACTAGTCTTCTACTGGAGTAGGTTCTACGAGACACAAATTAGACAGGAG
AGATCGAGTTTGAAGGCAGGAAGGCAGGCGATGGCGAGCATGGAGGGTCTGATCGGCCTG
ATGAACCGCATCCAGCGAGCCTGCACCGCCCTCGGAGACCACGGAGGTGGAGAAGGAGCC
AACCTCCCTACCCTCTGGGAGTCTCTCCCCACCATCGCCGTCGTCGGAGGCCAGAGTTCG
GGCAAGTCCTCCGTGCTAGAGAGCATTGTTGGCAGAGATTTCCTTCCCCGTGGTTCTGGA
ATCGTGACACGGAGGCCATTAGTTCTTCAGCTGCATCAGATCGACAAAGGGGCCCACGAT
TATGCAGAGTTCTTACACTTGCCCAAAACAAGGTTTTCAGATTTTGCTCTTGTTCGTCAA
GAAATTGCAGATGAGACAGATAGAGTGACTGGGAAAACTAAACAAATATCCCCTGTGCCA
ATACATCTCAGCATCTACTCACCCAACGTCGTGAACTTAACATTGATTGATCTTCCTGGA
TTGACAAAAGTCGCTGTAGagggacaacctgaaagtgttgttcatgatatagagaatATG
GTTCGGTCGTATGTTGAGAAGCCCAATTGTATCATTTTGGCTATATCTCCAGCAAACCAG
GACATTGCCACTTCTGATGCCATTAAGCTTTCGAAGGAGGTTGACCCATCAGGTGAGAGG
ACATTCGGTGTGTTGACAAAGTTGGACTTGATGGACAAGGGAACAAACGCTCTTGATGTT
CTTGAGGGAAGAGCCTATCGTCTTCAGTATCCGTGGGTTGGAATTGTCAACCGCTCACAA
GCAGATATTAACAGGAAAGTTGATATGATTGTTGCAAGAGAAAAGGAAAGAGAGTATTTT
GAAAATAGTCCTGATTATGCACACCTAGCCAGTAAGATGGGTTCTGTGTATCTAGCTAAG
CTTCTTTCTCAGCATCTTGAAGCCGTTATTAAAGCACGCATTCCTAGCATCACATCATTA
ATCAACAAAACTATAGATGAACTTGAATCGGAGCTGGATACCATTGGGAAAGAAGTGGCT
GCTGATCCAGGGGCTCAACTGTACACTATATTGGAGCTCTGTCGTGCTTTTGACCGTGTT
TTCAAGGAACATCTGGACGGAGGGAGATCAGGTGGTGATAAAATTTATGGCGTGTTTGAT
CATAAGCTCCCTGCCGCTTTTAGGAAGCTGCCTTTTGATCGTTATCTATCCGTGCAAAAT
GTGAAGAAGGTGGTATCAGAAGCAGATGGCTATCAGCCTCATCTTATTGCTCCTGAACAA
GGTTACCGTCGTCTTGTTGAAGCCGGCCTTGCGTATTTCAAGGGACCAGCTGAAGCTACA
GTCGATGCGGTCCATGTTGTTTTAAGGGACTTGGTGAGGAAATCCATAGGAGAGACAGAG
CCACTGAGAAGATTCCCTACCCTGCAAGCTGCGATTGCAACTGCTGCTAATGAAGCTCTG
GAAAGGTTTCGGGAGGATGGACGTAGCACTGCACTTCGGCTTGTTGACATGGAGGCATAT
TTGACAGTGGAATTCTTCCGGAAACTCCCGCAAGATCCAGATAGTGGCAGCAAGGTTGGG
AATAATACCAATGAATCCAATGGCTCAGGCTCAGGCTCAGTGACAGTGGACCGCTACGGC
GACGGGCACTACAGGAATATCGCGTCCAATGTGTCCCAGTACATAAAGATGGTGGGAGAC
CAACTGTTACACAAGATCCCAAAGGCGGTGGTGCACTGTCAGGTCCGAGAAGCCAAGAGG
TCTCTGCTTAACCATTTCTACGTGCACATCGGGAAGAAAGAGGCGAGCCAGTTTGGGCAT
TTACTGGATGAGGACCCAGCGATGCTTGAGCGTAGGCAGCAATGCTGGAAGAGGTTGGAG
CTGTACAAATCGGCTAGGGATGAAATCGACTCTGTCGCATGGACCAGGTAGACACAAACA
TATACATGGTGGCTAGTATCTTTTGTCGCAGCTGCGTGTAGTTTGGTTTGGGCAGATCTA
ACTTCCATTTGTCAGGCAGGCACTATTTTCCCTTGGTATATAGTATATACTATACTATCT
TACGAATTGATGGACGTTATATATCTGTATATTTTGTCAGTAGATCATCCTTCGTACATG
TGCACCCCGACCCGTGCCATGCTGGTTTCAACAGTTTTTCTTTTGTTATTCTTTCTAGTG
GTTGGCTTCTCTCTGTTGTC

CDS

1881 bp

>Os09t0572900-01 Dynamin-related protein 1E, Negative regulation of programmed cell death, Control of cytochrome c release
ATGGCGAGCATGGAGGGTCTGATCGGCCTGATGAACCGCATCCAGCGAGCCTGCACCGCC
CTCGGAGACCACGGAGGTGGAGAAGGAGCCAACCTCCCTACCCTCTGGGAGTCTCTCCCC
ACCATCGCCGTCGTCGGAGGCCAGAGTTCGGGCAAGTCCTCCGTGCTAGAGAGCATTGTT
GGCAGAGATTTCCTTCCCCGTGGTTCTGGAATCGTGACACGGAGGCCATTAGTTCTTCAG
CTGCATCAGATCGACAAAGGGGCCCACGATTATGCAGAGTTCTTACACTTGCCCAAAACA
AGGTTTTCAGATTTTGCTCTTGTTCGTCAAGAAATTGCAGATGAGACAGATAGAGTGACT
GGGAAAACTAAACAAATATCCCCTGTGCCAATACATCTCAGCATCTACTCACCCAACGTC
GTGAACTTAACATTGATTGATCTTCCTGGATTGACAAAAGTCGCTGTAGagggacaacct
gaaagtgttgttcatgatatagagaatATGGTTCGGTCGTATGTTGAGAAGCCCAATTGT
ATCATTTTGGCTATATCTCCAGCAAACCAGGACATTGCCACTTCTGATGCCATTAAGCTT
TCGAAGGAGGTTGACCCATCAGGTGAGAGGACATTCGGTGTGTTGACAAAGTTGGACTTG
ATGGACAAGGGAACAAACGCTCTTGATGTTCTTGAGGGAAGAGCCTATCGTCTTCAGTAT
CCGTGGGTTGGAATTGTCAACCGCTCACAAGCAGATATTAACAGGAAAGTTGATATGATT
GTTGCAAGAGAAAAGGAAAGAGAGTATTTTGAAAATAGTCCTGATTATGCACACCTAGCC
AGTAAGATGGGTTCTGTGTATCTAGCTAAGCTTCTTTCTCAGCATCTTGAAGCCGTTATT
AAAGCACGCATTCCTAGCATCACATCATTAATCAACAAAACTATAGATGAACTTGAATCG
GAGCTGGATACCATTGGGAAAGAAGTGGCTGCTGATCCAGGGGCTCAACTGTACACTATA
TTGGAGCTCTGTCGTGCTTTTGACCGTGTTTTCAAGGAACATCTGGACGGAGGGAGATCA
GGTGGTGATAAAATTTATGGCGTGTTTGATCATAAGCTCCCTGCCGCTTTTAGGAAGCTG
CCTTTTGATCGTTATCTATCCGTGCAAAATGTGAAGAAGGTGGTATCAGAAGCAGATGGC
TATCAGCCTCATCTTATTGCTCCTGAACAAGGTTACCGTCGTCTTGTTGAAGCCGGCCTT
GCGTATTTCAAGGGACCAGCTGAAGCTACAGTCGATGCGGTCCATGTTGTTTTAAGGGAC
TTGGTGAGGAAATCCATAGGAGAGACAGAGCCACTGAGAAGATTCCCTACCCTGCAAGCT
GCGATTGCAACTGCTGCTAATGAAGCTCTGGAAAGGTTTCGGGAGGATGGACGTAGCACT
GCACTTCGGCTTGTTGACATGGAGGCATATTTGACAGTGGAATTCTTCCGGAAACTCCCG
CAAGATCCAGATAGTGGCAGCAAGGTTGGGAATAATACCAATGAATCCAATGGCTCAGGC
TCAGGCTCAGTGACAGTGGACCGCTACGGCGACGGGCACTACAGGAATATCGCGTCCAAT
GTGTCCCAGTACATAAAGATGGTGGGAGACCAACTGTTACACAAGATCCCAAAGGCGGTG
GTGCACTGTCAGGTCCGAGAAGCCAAGAGGTCTCTGCTTAACCATTTCTACGTGCACATC
GGGAAGAAAGAGGCGAGCCAGTTTGGGCATTTACTGGATGAGGACCCAGCGATGCTTGAG
CGTAGGCAGCAATGCTGGAAGAGGTTGGAGCTGTACAAATCGGCTAGGGATGAAATCGAC
TCTGTCGCATGGACCAGGTAG

Protein

627 aa

>Os09t0572900-01 Dynamin-related protein 1E, Negative regulation of programmed cell death, Control of cytochrome c release
MASMEGLIGLMNRIQRACTALGDHGGGEGANLPTLWESLPTIAVVGGQSSGKSSVLESIV
GRDFLPRGSGIVTRRPLVLQLHQIDKGAHDYAEFLHLPKTRFSDFALVRQEIADETDRVT
GKTKQISPVPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPESVVHDIENMVRSYVEKPNC
IILAISPANQDIATSDAIKLSKEVDPSGERTFGVLTKLDLMDKGTNALDVLEGRAYRLQY
PWVGIVNRSQADINRKVDMIVAREKEREYFENSPDYAHLASKMGSVYLAKLLSQHLEAVI
KARIPSITSLINKTIDELESELDTIGKEVAADPGAQLYTILELCRAFDRVFKEHLDGGRS
GGDKIYGVFDHKLPAAFRKLPFDRYLSVQNVKKVVSEADGYQPHLIAPEQGYRRLVEAGL
AYFKGPAEATVDAVHVVLRDLVRKSIGETEPLRRFPTLQAAIATAANEALERFREDGRST
ALRLVDMEAYLTVEFFRKLPQDPDSGSKVGNNTNESNGSGSGSVTVDRYGDGHYRNIASN
VSQYIKMVGDQLLHKIPKAVVHCQVREAKRSLLNHFYVHIGKKEASQFGHLLDEDPAMLE
RRQQCWKRLELYKSARDEIDSVAWTR*

5'UTR

chr09:22916643..22916732 (- strand) : 90 bp

CDS

chr09:22916499..22916642 (- strand) : 144 bp

chr09:22916271..22916334 (- strand) : 64 bp

chr09:22916086..22916193 (- strand) : 108 bp

chr09:22915721..22915822 (- strand) : 102 bp

chr09:22915191..22915241 (- strand) : 51 bp

chr09:22915006..22915067 (- strand) : 62 bp

chr09:22914701..22914791 (- strand) : 91 bp

chr09:22914390..22914454 (- strand) : 65 bp

chr09:22914013..22914207 (- strand) : 195 bp

chr09:22913806..22913925 (- strand) : 120 bp

chr09:22913614..22913684 (- strand) : 71 bp

chr09:22912870..22913095 (- strand) : 226 bp

chr09:22912536..22912586 (- strand) : 51 bp

chr09:22912054..22912455 (- strand) : 402 bp

chr09:22911836..22911964 (- strand) : 129 bp

3'UTR

chr09:22911567..22911835 (- strand) : 269 bp

FASTA

>Os09t0572900-01 class=Sequence position=chr09:22911567..22916732 (- strand)
CTTTCTTGTC TACTAGTCTT CTACTGGAGT AGGTTCTACG AGACACAAAT TAGACAGGAG AGATCGAGTT TGAAGGCAGG
AAGGCAGGCG ATGGCGAGCA TGGAGGGTCT GATCGGCCTG ATGAACCGCA TCCAGCGAGC CTGCACCGCC CTCGGAGACC
ACGGAGGTGG AGAAGGAGCC AACCTCCCTA CCCTCTGGGA GTCTCTCCCC ACCATCGCCG TCGTCGGAGG CCAGGTCATT
TGCTTCCTTC CTTCCTTGCT TCAATTAAAT GGATTTTTTC TTTTCTCTTT AACCTTATTA TTATTTTTAT TATTATACTC
CTATGATTAA TGATGCATGG ATTGGATGCT GATTTCTAGA CTTTGTAATT CATTTCATTT TGGCTTGTGC ACAAACAGAG
TTCGGGCAAG TCCTCCGTGC TAGAGAGCAT TGTTGGCAGA GATTTCCTTC CCCGTGGTTC TGGTAATTAT AATAACCTCA
TTCACCCCAG TTTCCCTTTC AACACTATCT TACCTCCCCT CATCTATCAT CTAATCTAGG AATCGTGACA CGGAGGCCAT
TAGTTCTTCA GCTGCATCAG ATCGACAAAG GGGCCCACGA TTATGCAGAG TTCTTACACT TGCCCAAAAC AAGGTTTTCA
GATTTTGGTG CGAACTTGAA ATCAATCCTT CCCCGTTAAT TTCTTTATAC AGCTTTGCAA TATTGTAATG TAAACCTCAC
ATCTCTGTAT CCTGCTGTTT CTTGCAAATA ATGCTTTAGT TCAAGTGTCT GTCCTATTGC ACTATTCTGT TTCCACTGCT
TTATTTCTGA TTTAAAATAG CACTGCCAAA CTTATATATC AACATCTTTC TAAAACAAAA GGAAAACTTA TACTTAACAG
CACCACTTAT TTTTCTCTAC TGTGGTGTAG CTCTTGTTCG TCAAGAAATT GCAGATGAGA CAGATAGAGT GACTGGGAAA
ACTAAACAAA TATCCCCTGT GCCAATACAT CTCAGCATCT ACTCACCCAA CGGTAACCTC TTCCTGTTGC AAATGTGCAA
CCTATGTTGT AATCCCCTCC CAGAAATGTA TCTCCATCTT GCAAATTGAA TTGAACTATT CTCTGGACCA CCCGAGCCCT
GCGATTGTGT TTCACTGGTG GAACTCTGTT AACCCTGTAA CATAAACTTT TTGAAATGTA TGGGATCTTC ACGAAGAAAG
AAAGTTTTAG GTGGGCCAGT TTGCGGCCTT TCATATAATC TTCAAAAGAT ACTCTATGAG TATATCTGGA CATTAAGATG
CTTTGAATGA TATACCATGC ATGCAATAGT TTTGTGATTA TCCAAGTTTG TAGCTTTCTA CAGTTTATCC AGATTCTCTC
ATACTATATA GGATTTTGAA TCATTGTCAA AGACTCCTCA ATTTAGACTA GGATTTTTAA TGTCTGCTTC ACATATTTCT
CTCATACTAT ACATTGATTG GCTAATAGTA GTTTACTCCC ATATGTTGCA GTCGTGAACT TAACATTGAT TGATCTTCCT
GGATTGACAA AAGTCGCTGT AGGTATGCAC TATTATGTCC TTTTTTAATC AAAGATTTAA TTCTCTCTCT TTTGATACTG
TGTTTAGTTT ATCGTGCATC CCCCCCCCCC ACCTTCCTCT aacttgttca acttctaatt cacagaggga caacctgaaa
gtgttgttca tgatatagag aatATGGTTC GGTCGTATGT TGAGAAGGTA ATCAACAAAC GAAGTAGCAT TTTTTTTAAT
ACCATGTCTT CAGCATTCTT GTACTAGTAG CAAATTGATG ACATTAACTT GGCTGCTGTT TTGGTTGTTT AATTATTCAC
ACCCAAATAA CTTTAGGTGT TATATTGTTT AATTAATTTC TGGTGTTCAA ATTTGAGAAC TTATACAAGG CTAATAGGTT
ACTTTGTATG ATATTTTGCA GCCCAATTGT ATCATTTTGG CTATATCTCC AGCAAACCAG GACATTGCCA CTTCTGATGC
CATTAAGCTT TCGAAGGAGG TTGACCCATC AGGTACTAAA ATTCAGTGCA CATAGAGGGC AAGAGATAGT GACTCTTTTA
CTTTTATTTT CTGCGGAGAA CTCATACAAA TAAAGTAAAG TATGTTGCTG TAAACTTTGA TGGTTTGTTA TAGCTCTACA
GCTAAGATTG TTATCTTCTA CAGAATGCTG CAGAATAGTT TGCTTTTATC ATGATCCTAT CTGACTGGAT TTACCATCCA
TTTTTATTTT CTGGATGACA ATTTTTCTCT TTTACAAGGT GAGAGGACAT TCGGTGTGTT GACAAAGTTG GACTTGATGG
ACAAGGGAAC AAACGCTCTT GATGTAAGAT TGAACTTGCC TGCCCTGACA AACAGTAGTC TGTCTGCACA TTGTCAGTTT
CAGAATATCT ACATGCAGCC TTTTTTTGTT CTTAATGTTC ATATCATACC TCTGACCTGT CATTTATCTG TAAATTTAAC
CTTGTTCTAT CTGGACTACC TCGACTATTT TCATTTCCCC CAAAGGTTCT TGAGGGAAGA GCCTATCGTC TTCAGTATCC
GTGGGTTGGA ATTGTCAACC GCTCACAAGC AGATATTAAC AGGAAAGTTG ATATGATTGT TGCAAGAGAA AAGGAAAGAG
AGTATTTTGA AAATAGTCCT GATTATGCAC ACCTAGCCAG TAAGATGGGT TCTGTGTATC TAGCTAAGCT TCTTTCTCAG
GTACCTCAAA CTTGAAATTT CTCGTTTCTT TGAGTTGGTA TATGAGCAAG GCTTAGGACT TGCATAATTG CTTTATAACA
TTTTCAGCAT CTTGAAGCCG TTATTAAAGC ACGCATTCCT AGCATCACAT CATTAATCAA CAAAACTATA GATGAACTTG
AATCGGAGCT GGATACCATT GGGAAAGAAG TGGCTGCTGA TCCAGGGGTC AGTCATTCAT ATATATTTTG TACTAAAAGT
AGTTTTTGCC GGGTCTGTAC TAAAAGTAGT TACAGGAGTA TTTGTCTTGT TCAATTTTAT ATTCACCGCT TCCATAATGT
TGTGCCAGGC TCAACTGTAC ACTATATTGG AGCTCTGTCG TGCTTTTGAC CGTGTTTTCA AGGAACATCT GGACGGAGGG
TGGGTAATTA ATTATCTGTC ATCATCTTAA TGGCTTCTTG TATCTCTCTT CTAATTATGT AAAGCGCTTT AGGTTCAGTT
CTAGGTTTTC ATTTTAGAAA TACTTATCGT TATCATAATA TTTTGACTTG TTGCATAAAT GTTGCTTATG AACCATAGGT
AGTTGCATGG CGTATCAACA TCACTCGTCT CAGGATAATA CATGCTGAAA GTGCACCTGT TTATGTTGAG TTCCCGGGAC
TTATATTGTA TCTTCCATGT GAACATGAAA AGAATTTACA GAACATGCCT ATCTTTTCAG AAGATGGAAG TGCATACTTC
ATAATGTGTA AACGGATTTA GTCAAAAAAA ATAATGTGTA AACAGAATTT ATAAAGTGTT CATAAGTTTT ATACGACACC
AATATACCTA GATTTTTTTT TAATTAGTTG TCATTTAATA TGATGAGATC TTGTCCAATT ACAATATTAT AACGTTCATT
TTACTCCTTT AACTGTTTGG GTGCCTAACT GTTGCAGGAG ATCAGGTGGT GATAAAATTT ATGGCGTGTT TGATCATAAG
CTCCCTGCCG CTTTTAGGAA GCTGCCTTTT GATCGTTATC TATCCGTGCA AAATGTGAAG AAGGTGGTAT CAGAAGCAGA
TGGCTATCAG CCTCATCTTA TTGCTCCTGA ACAAGGTTAC CGTCGTCTTG TTGAAGCCGG CCTTGCGTAT TTCAAGGGAC
CAGCTGAAGC TACAGTCGAT GCGGTAGCTG ACTTTCTATA TATACATCTG TGCTGATTGA TTTGTTGTCC GTTAGTTTCT
TTAATCAGTG GCCACCAGGC CAGTAGAGTA GGCACTTTGT GCTGTACGCT TTACTTCCTG GAGTATATAT ATGCTAGTAG
TTATATTTGA TATGTGCCAA TTAATAATAC TCTGATGTTG GTGTTAGGTG CGCATTTGAT GAGGTGTCCT AGCTTCCAAA
CCTTTGGAAG GAATAATGCT ATATATCCCA ATGTGTCTGA TCTGCCAAAT ATATTATTTT TTTCAGGTCC ATGTTGTTTT
AAGGGACTTG GTGAGGAAAT CCATAGGAGA GACAGAGGTT AGGAAGAATG AATATATCCA TATTTCTTTG TGTTTTTGGA
AAATGGTACT TTATATATGT TTTCTCACTA ATTGCAGCCA CTGAGAAGAT TCCCTACCCT GCAAGCTGCG ATTGCAACTG
CTGCTAATGA AGCTCTGGAA AGGTTTCGGG AGGATGGACG TAGCACTGCA CTTCGGCTTG TTGACATGGA GGCATATTTG
ACAGTGGAAT TCTTCCGGAA ACTCCCGCAA GATCCAGATA GTGGCAGCAA GGTTGGGAAT AATACCAATG AATCCAATGG
CTCAGGCTCA GGCTCAGTGA CAGTGGACCG CTACGGCGAC GGGCACTACA GGAATATCGC GTCCAATGTG TCCCAGTACA
TAAAGATGGT GGGAGACCAA CTGTTACACA AGATCCCAAA GGCGGTGGTG CACTGTCAGG TCCGAGAAGC CAAGAGGTCT
CTGCTTAACC ATTTCTACGT GCACATCGGG AAGAAAGAGG TACTAATTAA CTAGTAGTAG TAGTTAATCT CCTTGTCATC
TAGGGTGAAT GCATGGAATG GAAGTAATGA GTTTTGTGGT TGGAGCAGGC GAGCCAGTTT GGGCATTTAC TGGATGAGGA
CCCAGCGATG CTTGAGCGTA GGCAGCAATG CTGGAAGAGG TTGGAGCTGT ACAAATCGGC TAGGGATGAA ATCGACTCTG
TCGCATGGAC CAGGTAGACA CAAACATATA CATGGTGGCT AGTATCTTTT GTCGCAGCTG CGTGTAGTTT GGTTTGGGCA
GATCTAACTT CCATTTGTCA GGCAGGCACT ATTTTCCCTT GGTATATAGT ATATACTATA CTATCTTACG AATTGATGGA
CGTTATATAT CTGTATATTT TGTCAGTAGA TCATCCTTCG TACATGTGCA CCCCGACCCG TGCCATGCTG GTTTCAACAG
TTTTTCTTTT GTTATTCTTT CTAGTGGTTG GCTTCTCTCT GTTGTC

Locus: Os09g0572900

Loading...

Locus: Os09g0572900

Loading...